PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sp_046240_wzmm.t1
Common NameSOVF_046240
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Anserineae; Spinacia
Family Nin-like
Protein Properties Length: 274aa    MW: 31557.6 Da    PI: 4.8108
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sp_046240_wzmm.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK83.71.7e-26105155252
             RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                        +k+++ e +s+yF++pi+ AAkeL+v+lT+LK++CR++GI+RWPhRk+ sl
  Sp_046240_wzmm.t1 105 SKTLTKEIISQYFYMPITRAAKELNVGLTLLKKRCRELGIQRWPHRKLMSL 155
                        5899********************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.80391175IPR003035RWP-RK domain
PfamPF020422.0E-22107155IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0051302Biological Processregulation of cell division
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MSSIDATPLM ECFPDDPSYP FYSSLDIMST FTIPHVIQDT KTIYDGYGNG FEGLHDLELE  60
KAPPLPPPLP PPLGLCHDDS NHQTREDLVE NKNVFQEKEN NNNVSKTLTK EIISQYFYMP  120
ITRAAKELNV GLTLLKKRCR ELGIQRWPHR KLMSLQTLIR NVQEMEKEGG DKNEAKLREA  180
IQILEQEKKL MEEMPDLQLE TRTKRLRQAC FKANYKKRKL INNMNNYDIS PQSSSSASTS  240
NDNANYEISK GNNDDYGDDD EDVMDVMNFP YFCS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021859864.10.0protein RKD1-like
TrEMBLA0A0K9RQK20.0A0A0K9RQK2_SPIOL; Uncharacterized protein
STRINGXP_010678556.11e-105(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.15e-56RWP-RK domain-containing protein