PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sp_041650_wnss.t1
Common NameSOVF_041650
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Anserineae; Spinacia
Family TALE
Protein Properties Length: 728aa    MW: 79092.9 Da    PI: 7.6102
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sp_041650_wnss.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.26.5e-094835201954
                        HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
           Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                        Fe   ++yps +++  L++++gL+ +qV++WF N R +
  Sp_041650_wnss.t1 483 FEHflHPYPSDADKHLLSRQTGLSRNQVSNWFINARVR 520
                        554458******************************88 PP

2BELL119.61.4e-38343414172
               BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                        +r e+q++k+kLl +l+eVd+rY++y+eq+q+v++sF+ ++g+g+a pYt+lA+ka+SrhFrcLkdai  q+
  Sp_041650_wnss.t1 343 DRIEHQRRKVKLLAMLDEVDRRYNHYCEQMQMVVNSFDLIMGYGAAIPYTALAQKAMSRHFRCLKDAILVQL 414
                        589*****************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005748.2E-72262412IPR006563POX domain
PfamPF075268.1E-51267410IPR006563POX domain
PROSITE profilePS5007112.098461524IPR001356Homeobox domain
SMARTSM003893.8E-9464528IPR001356Homeobox domain
CDDcd000865.06E-12464525No hitNo description
SuperFamilySSF466892.18E-16466531IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.0E-27467530IPR009057Homeodomain-like
PfamPF059209.8E-18481520IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009965Biological Processleaf morphogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 728 aa     Download sequence    Send to blast
MLSEMFNFGH GSSSGPGAGP ELLDYRRAVA GMGSADWYGN SRQNDQHNHH IEEIQQHQQQ  60
QHRQMGGISA HDSAAAAMQL FMTNPQPRSP SPPPQQPPPP PPGIQPGGGF HSVVSTTNTT  120
NNTHPNFWNN PAELGRIVEG QGFSNLSLSL SSSLQAAKQV EEEFRQIGVG GGGGPGGGGG  180
GDPHIMFFNQ HQPNTNNNNT RGGIGATSTT TSSQQGGHFF ENLAPSPHHL QQGGGVGGAF  240
GGQQIHQVHI GYGSTAAATS SLGVVNVLRN SKYAKPTQDL LEEFCSVGRG QIKKPTNNNK  300
LGRQNSSNQN HPSTSGGGGG GSGGGGGGSS SSTKEPPQLS ASDRIEHQRR KVKLLAMLDE  360
VDRRYNHYCE QMQMVVNSFD LIMGYGAAIP YTALAQKAMS RHFRCLKDAI LVQLKNSCEM  420
LGEKDPTTSS GITKGETPRL KVLEQSLRQQ RAFHQMGMMD QEAWRPQRGL PERSVNFLRA  480
WLFEHFLHPY PSDADKHLLS RQTGLSRNQV SNWFINARVR LWKPMIEEMY QQESKEMEEE  540
RERERDGNQT SSSTSNSNSF ATQHQQQQQQ NQQQQQQNQQ QQQQQQQQQQ AAAENAQNPM  600
PSSSSVSVSA LTEGKRSADT MTTLGPLPNH HHDHDPSILA INTTHQHHQN HHRNHHQPPQ  660
TSSHAAAVVI DETCHFGGGI DNVGPTTMIR FGAPSGDVSL TLGLRHAGNA PEKGGGGGGF  720
SIRDFGSC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A2e-15470528563Homeobox protein Meis2
3k2a_B2e-15470528563Homeobox protein Meis2
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1314328SGGGGGGSGGGGGGS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021847822.10.0BEL1-like homeodomain protein 4
TrEMBLA0A0K9RS330.0A0A0K9RS33_SPIOL; Uncharacterized protein
STRINGXP_010680937.10.0(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36870.21e-133BEL1-like homeodomain 2