PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sp_025490_kdjm.t1
Common NameSOVF_025490
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Anserineae; Spinacia
Family MIKC_MADS
Protein Properties Length: 218aa    MW: 24932.4 Da    PI: 6.1685
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sp_025490_kdjm.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF83.81e-26957149
                       S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
             SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                       +ri+n + rqvtf+kRr+g++KKA+ELS+LCdaev +iifsstgk+ye 
  Sp_025490_kdjm.t1  9 ERIDNLTSRQVTFTKRRKGLFKKAKELSILCDAEVGIIIFSSTGKVYEI 57
                       69*********************************************95 PP

2K-box72.99.3e-2575169698
              K-box   6 gks..leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLr 95 
                         ++  + +++a+ ++ e++ L++++e L+++ R+llGe+L++Ls+++L+ Le qLe + ++iR +K+e+++++i+el k e ++++en++L+
  Sp_025490_kdjm.t1  75 ENQvlNPTSEAQLWKVEAEGLRQQLEDLRKNSRQLLGEELSELSIEHLETLEAQLEMGTRSIRLRKEEIFKNKIQELNKTEIMVHQENMELH 166
                        44445778999********************************************************************************* PP

              K-box  96 kkl 98 
                        kk+
  Sp_025490_kdjm.t1 167 KKI 169
                        *98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006630.011161IPR002100Transcription factor, MADS-box
SMARTSM004327.5E-38160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.83E-30180IPR002100Transcription factor, MADS-box
CDDcd002651.36E-37274No hitNo description
PRINTSPR004041.2E-26323IPR002100Transcription factor, MADS-box
PfamPF003193.5E-241056IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-263859IPR002100Transcription factor, MADS-box
PfamPF014861.6E-2282169IPR002487Transcription factor, K-box
PROSITE profilePS5129713.76185175IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008134Molecular Functiontranscription factor binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 218 aa     Download sequence    Send to blast
MGRGKISIER IDNLTSRQVT FTKRRKGLFK KAKELSILCD AEVGIIIFSS TGKVYEIASH  60
CMQSLLERYY KANEENQVLN PTSEAQLWKV EAEGLRQQLE DLRKNSRQLL GEELSELSIE  120
HLETLEAQLE MGTRSIRLRK EEIFKNKIQE LNKTEIMVHQ ENMELHKKIN LMRQEMVELQ  180
KKNEVSGGQG KDDQEGGGAS SSAASAYDTY DPIELKLS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A6e-20177177MEF2C
5f28_B6e-20177177MEF2C
5f28_C6e-20177177MEF2C
5f28_D6e-20177177MEF2C
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021717234.11e-145MADS-box transcription factor 23-like isoform X2
RefseqXP_021776241.11e-145MADS-box transcription factor 23-like isoform X2
SwissprotQ6EP492e-72MAD27_ORYSJ; MADS-box transcription factor 27
TrEMBLA0A0K9RUZ71e-157A0A0K9RUZ7_SPIOL; Uncharacterized protein
STRINGXP_010691448.11e-135(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37940.15e-61AGAMOUS-like 21
Publications ? help Back to Top
  1. Puig J, et al.
    Analysis of the expression of the AGL17-like clade of MADS-box transcription factors in rice.
    Gene Expr. Patterns, 2013 Jun-Jul. 13(5-6): p. 160-70
    [PMID:23466806]
  2. Yu C, et al.
    The effects of fluctuations in the nutrient supply on the expression of five members of the AGL17 clade of MADS-box genes in rice.
    PLoS ONE, 2014. 9(8): p. e105597
    [PMID:25140876]