PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sp_008480_ejxe.t1
Common NameSOVF_008480
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Anserineae; Spinacia
Family TALE
Protein Properties Length: 711aa    MW: 77989.6 Da    PI: 8.0048
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sp_008480_ejxe.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.21.6e-094214581954
                        HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
           Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                        Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  Sp_008480_ejxe.t1 421 FEHflHPYPKDSDKHMLAKQTGLTRSQVSNWFINARVR 458
                        554459******************************88 PP

2BELL118.53e-38280351172
               BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                        +rqelq+kkakL+++l+eV++rY+qy+ q+q+v+ssFe++ag gsak+YtslAlk+iS++FrcLkd i++qi
  Sp_008480_ejxe.t1 280 QRQELQMKKAKLINMLDEVEQRYRQYNSQMQVVVSSFEQAAGNGSAKLYTSLALKTISKQFRCLKDTIMSQI 351
                        69*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005747.4E-55186349IPR006563POX domain
PfamPF075263.2E-47191347IPR006563POX domain
PROSITE profilePS5007112.244399462IPR001356Homeobox domain
SMARTSM003892.3E-9402466IPR001356Homeobox domain
CDDcd000864.47E-12402463No hitNo description
SuperFamilySSF466897.27E-17403468IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.4E-29405468IPR009057Homeodomain-like
PfamPF059203.0E-18419458IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009610Biological Processresponse to symbiotic fungus
GO:0009737Biological Processresponse to abscisic acid
GO:0010197Biological Processpolar nucleus fusion
GO:0010201Biological Processresponse to continuous far red light stimulus by the high-irradiance response system
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 711 aa     Download sequence    Send to blast
MMATYFHGGS EIQAAGGDHN LQTLYLMNPN FISAYSEAQT PPNMLFLNPP NALSQGNLSH  60
APPSQQQQFI GIPLSAAGGP HPSDDHSRPS PSSSGSQQLQ HQHHHHHHNQ IPAALHGVSV  120
SRVHPNLWSP NHPGPIQSTA SGPDMAEQMG FRRPMTAQGL SLSLSPGQQQ NQSQVTLAGV  180
SSTSLAASSG VIFGSKYLKA AQEVLEEVVN VGTNNGNNNG DNRIGESSGA HKEKAKAVTA  240
TTREQSSVGE VASRGGNGGG EGESSISGGS KKVAELSTAQ RQELQMKKAK LINMLDEVEQ  300
RYRQYNSQMQ VVVSSFEQAA GNGSAKLYTS LALKTISKQF RCLKDTIMSQ IKGTRKSLGE  360
EDSNSNGVKL ESGAGSRLRF VDHQLRQQRA LQQLGMMQQN AWRPQRGLPE RAVSVLRAWL  420
FEHFLHPYPK DSDKHMLAKQ TGLTRSQVSN WFINARVRLW KPMVEEMYLE EVKTQEQKSG  480
NSEDNTTSAN KNNKSPKNIN DQSTTKESVM EQQQQHEADH TTNDMISNLS AMSTTSSQGF  540
TLIGSSSDME SLMARSPKKQ RSNSEMQNSP SSILSMDMEL KPVDHHHQRH SFMMTNHEDA  600
GTGFNPYLVN DMTGRFNPDQ MNSHPYHGNG VSLTLGLPHC ENLSLGNHQQ NFIPNQGIQL  660
GRRLDIGSGD HPDFCGISMA QPSHPNNGFQ TIDIQTRKRF AAHQLLHDFV A
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A2e-16408466563Homeobox protein Meis2
3k2a_B2e-16408466563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021857854.10.0BEL1-like homeodomain protein 1
TrEMBLA0A0K9S0H60.0A0A0K9S0H6_SPIOL; Uncharacterized protein
STRINGXP_010685441.10.0(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.31e-111BEL1-like homeodomain 1