PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sp_003060_scgs.t1
Common NameSOVF_003060
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Anserineae; Spinacia
Family Nin-like
Protein Properties Length: 263aa    MW: 29043.2 Da    PI: 8.0331
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sp_003060_scgs.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK55.51.1e-171458448
             RWP-RK  4 eisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRk 48
                       ++s+ed+sk Fslp+ +AA  Lg +++vLK+iC ++G++RWPhRk
  Sp_003060_scgs.t1 14 SLSFEDVSKLFSLPLSEAADILGASTSVLKKICNENGLERWPHRK 58
                       79******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151914.732181IPR003035RWP-RK domain
PfamPF020424.8E-171558IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
MSSVQNQKSS IDHSLSFEDV SKLFSLPLSE AADILGASTS VLKKICNENG LERWPHRKYL  60
AGKSIEDIKN EAAKEKSKPL RGVSPKSNVT TSSPATSSPS SRPNIDPPSI NPRITDPDRT  120
RPITNNAQQQ PGSKAAAATW RSNQMLASGL TTETSTDEFK YGFPSTGLSE CTYRWWGRSF  180
NGGNGVSKDD TKTNVEDDDD ATCEEKTDSM EEDNRDEVSL SGIRKRAMEE GKKALKFNVL  240
KKYGVDKLGN EEKILLRRLY QTS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021862986.10.0protein NLP3-like
TrEMBLA0A0K9S2450.0A0A0K9S245_SPIOL; Uncharacterized protein
STRINGXP_010673598.11e-89(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35590.11e-09RWP-RK domain-containing protein