PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Sof020014 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 125aa MW: 14275.3 Da PI: 10.5234 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 113 | 3.1e-35 | 8 | 96 | 38 | 128 |
NAM 38 diykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 ++yk++Pw+Lp+k++++ekewyfFs+rd+ky++g+r+nra+ +gyWka+g dk+v s + v +kk Lvfy+g+ pkg+kt+W+mheyrl Sof020014 8 HLYKFDPWQLPEKAYGGEKEWYFFSPRDRKYPNGSRPNRAAGTGYWKASGADKPVGS--PRPVAIKKALVFYSGKPPKGVKTNWIMHEYRL 96 79*********999999**************************************99..779***************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51005 | 39.221 | 1 | 121 | IPR003441 | NAC domain |
SuperFamily | SSF101941 | 8.37E-38 | 8 | 102 | IPR003441 | NAC domain |
Pfam | PF02365 | 6.7E-15 | 18 | 96 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 125 aa Download sequence Send to blast |
MDCGGALHLY KFDPWQLPEK AYGGEKEWYF FSPRDRKYPN GSRPNRAAGT GYWKASGADK 60 PVGSPRPVAI KKALVFYSGK PPKGVKTNWI MHEYRLADVD RSAAARKKTN NSLRICQEHS 120 RMKVW |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 2e-45 | 7 | 120 | 52 | 167 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 2e-45 | 7 | 120 | 52 | 167 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 2e-45 | 7 | 120 | 52 | 167 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 2e-45 | 7 | 120 | 52 | 167 | NO APICAL MERISTEM PROTEIN |
3swm_A | 2e-45 | 1 | 120 | 49 | 170 | NAC domain-containing protein 19 |
3swm_B | 2e-45 | 1 | 120 | 49 | 170 | NAC domain-containing protein 19 |
3swm_C | 2e-45 | 1 | 120 | 49 | 170 | NAC domain-containing protein 19 |
3swm_D | 2e-45 | 1 | 120 | 49 | 170 | NAC domain-containing protein 19 |
3swp_A | 2e-45 | 1 | 120 | 49 | 170 | NAC domain-containing protein 19 |
3swp_B | 2e-45 | 1 | 120 | 49 | 170 | NAC domain-containing protein 19 |
3swp_C | 2e-45 | 1 | 120 | 49 | 170 | NAC domain-containing protein 19 |
3swp_D | 2e-45 | 1 | 120 | 49 | 170 | NAC domain-containing protein 19 |
4dul_A | 2e-45 | 7 | 120 | 52 | 167 | NAC domain-containing protein 19 |
4dul_B | 2e-45 | 7 | 120 | 52 | 167 | NAC domain-containing protein 19 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Sof.21317 | 0.0 | callus| root| seed |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in roots and embryo. Weakly expressed in callus. {ECO:0000269|PubMed:10660065}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that binds to the promoter of the stress response gene LEA19. Involved in tolerance to abiotic stresses. {ECO:0000269|PubMed:20632034}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by dehydration, salt stress, cold stress, abscisic acid (ABA) and methyl jasmonate. {ECO:0000269|PubMed:20632034}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001308992.1 | 1e-68 | uncharacterized protein LOC100384376 | ||||
Refseq | XP_002450434.1 | 1e-68 | NAC domain-containing protein 71 | ||||
Swissprot | Q53NF7 | 8e-62 | NAC71_ORYSJ; NAC domain-containing protein 71 | ||||
TrEMBL | A0A1X7YEW9 | 3e-69 | A0A1X7YEW9_MAIZE; Uncharacterized protein | ||||
TrEMBL | C0PNU1 | 4e-69 | C0PNU1_MAIZE; Uncharacterized protein | ||||
STRING | Sb05g005450.1 | 6e-68 | (Sorghum bicolor) | ||||
STRING | GRMZM2G123667_P02 | 5e-68 | (Zea mays) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G77450.1 | 2e-59 | NAC domain containing protein 32 |
Publications ? help Back to Top | |||
---|---|---|---|
|