PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sof019577
Organism
Saccharum officinarum
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
Family G2-like
Protein Properties Length: 136aa    MW: 14673 Da    PI: 4.8894
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Sof#S17367924PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like78.67.5e-252168956
    G2-like  9 eLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56
               eL ++Fv a++qLG +e+AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Sof019577 21 ELERQFVAALNQLGSPEVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 68
               899*******************************************97 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
TIGRFAMsTIGR015572.9E-212068IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.605.4E-222071IPR009057Homeodomain-like
SuperFamilySSF466891.47E-112071IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 136 aa     Download sequence    Send to blast
XADAWADAWA DAWGSALLVD ELERQFVAAL NQLGSPEVAT PKQIRELMKV DGLTNDEVKS  60
HLQKYRLHNR RAPGSGVVSQ PIVLVGGLWI PQEQSSSQSG SPHGPLHFST SGIAVSSAAT  120
ISCEEEDGRS ESYGWK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sof.82440.0inflorescence| meristem| seed
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed 3 days after germination, with a gradual decrease before the floral transition and remains at low levels afterward. {ECO:0000269|PubMed:25132385}.
UniprotTISSUE SPECIFICITY: Specifically expressed in vascular tissues of cotyledons, rosette leaves and cauline leaves. Not detected in the vegetative shoot apical meristem. {ECO:0000269|PubMed:25132385}.
Functional Description ? help Back to Top
Source Description
UniProtProbable factor involved in nitrate and phosphate signaling in roots. Integrates nitrate and phosphate starvation responses and adaptation of root architecture, depending on nutrient availabilities. Acts downstream of the nitrate sensor and transporter NPF6.3/NRT1.1. Represses primary root development in response to phosphate deficiency conditions, only when nitrate is present. {ECO:0000269|PubMed:25723764}.
UniProtTranscription factor acting as a flowering repressor, directly repressing FT expression in a dosage-dependent manner in the leaf vasculature. {ECO:0000269|PubMed:25132385}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by nitrate (PubMed:25723764). Down-regulated under nitrate deprivation conditions (PubMed:27419465). {ECO:0000269|PubMed:25723764, ECO:0000269|PubMed:27419465}.
UniProtINDUCTION: Up-regulated by SVP. Down-regulated by high temperature and gibberellic acid treatment. Not regulated by photoperiod, circadian rhythm under long days or vernalization. {ECO:0000269|PubMed:25132385}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001150001.12e-68myb-like DNA-binding domain, SHAQKYF class family protein
SwissprotQ9LS009e-27HHO1_ARATH; Transcription factor HHO1
SwissprotQ9ZQ852e-26EFM_ARATH; Myb family transcription factor EFM
TrEMBLA0A3L6FWW54e-67A0A3L6FWW5_MAIZE; Myb family transcription factor EFM
TrEMBLB6TK284e-67B6TK28_MAIZE; Myb-like DNA-binding domain, SHAQKYF class family protein
STRINGGRMZM2G173882_P017e-68(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G25790.11e-27G2-like family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Menz J,Li Z,Schulze WX,Ludewig U
    Early nitrogen-deprivation responses in Arabidopsis roots reveal distinct differences on transcriptome and (phospho-) proteome levels between nitrate and ammonium nutrition.
    Plant J., 2016. 88(5): p. 717-734
    [PMID:27419465]