PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Sof018471 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
|
||||||||
Family | HSF | ||||||||
Protein Properties | Length: 157aa MW: 17308.4 Da PI: 12.1972 | ||||||||
Description | HSF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | HSF_DNA-bind | 85 | 1e-26 | 29 | 94 | 2 | 67 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTTEEE--- CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYgFkkvkd 67 Fl+k+++++e+++++e+isw ++g+sfvv++++e+a+++Lp +Fkh nf+SFvRQLn+YgF+kv Sof018471 29 FLTKTHQMVEERATDEVISWADQGRSFVVWKPRELARDLLPLHFKHFNFSSFVRQLNTYGFRKVGA 94 9**************************************************************976 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.10 | 1.5E-29 | 24 | 106 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
SMART | SM00415 | 1.0E-32 | 25 | 121 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
SuperFamily | SSF46785 | 4.49E-25 | 25 | 106 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
PRINTS | PR00056 | 8.2E-18 | 29 | 52 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Pfam | PF00447 | 1.7E-23 | 29 | 105 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 8.2E-18 | 67 | 79 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PROSITE pattern | PS00434 | 0 | 68 | 92 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 8.2E-18 | 80 | 92 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 157 aa Download sequence Send to blast |
MEEAVAVAVA AASKSSGGRG GGGRRPAPFL TKTHQMVEER ATDEVISWAD QGRSFVVWKP 60 RELARDLLPL HFKHFNFSSF VRQLNTYGFR KVGAGPVXRF SNDNFPWRRA KAFWPASGRR 120 RSTTPKSFNK SVGSGGVNVG FLRRPLPRGS GEGTRLG |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5d8k_B | 3e-17 | 29 | 92 | 5 | 68 | Heat shock factor protein 2 |
5d8l_B | 3e-17 | 29 | 92 | 5 | 68 | Heat shock factor protein 2 |
5d8l_D | 3e-17 | 29 | 92 | 5 | 68 | Heat shock factor protein 2 |
5d8l_F | 3e-17 | 29 | 92 | 5 | 68 | Heat shock factor protein 2 |
5d8l_H | 3e-17 | 29 | 92 | 5 | 68 | Heat shock factor protein 2 |
Search in ModeBase |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 16 | 22 | GGRGGGG |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Sof.15625 | 0.0 | bud| crown| stem |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional regulator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000250}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002460330.1 | 2e-45 | heat stress transcription factor B-1 | ||||
Swissprot | Q67TP9 | 2e-41 | HSFB1_ORYSJ; Heat stress transcription factor B-1 | ||||
TrEMBL | A0A1E5VP74 | 3e-44 | A0A1E5VP74_9POAL; Heat stress transcription factor B-1 | ||||
TrEMBL | C5X2A9 | 4e-44 | C5X2A9_SORBI; Uncharacterized protein | ||||
STRING | Pavir.Bb02269.1.p | 1e-45 | (Panicum virgatum) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G11660.1 | 6e-30 | HSF family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|