PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Sof018372 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
|
||||||||
Family | DBB | ||||||||
Protein Properties | Length: 159aa MW: 17083 Da PI: 7.5741 | ||||||||
Description | DBB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-B_box | 24.3 | 6.6e-08 | 4 | 46 | 5 | 41 |
zf-B_box 5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41 C+ +e ++ C ++ lC+ C +e+H H++ p Sof018372 4 QCDACEGAAATVVCCADEAALCARCDVEIHAAnklaskHQRLP 46 7******99*********************6678888898877 PP | |||||||
2 | zf-B_box | 26.5 | 1.3e-08 | 54 | 86 | 2 | 34 |
zf-B_box 2 eerkCpeHeekelqlfCedCqqllCedClleeH 34 + ++C+ ++ek + +fC +++ l+C+dC + H Sof018372 54 KLPRCDVCQEKAAFIFCVEDRALFCRDCDEPVH 86 5799************************99877 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50119 | 10.011 | 1 | 47 | IPR000315 | B-box-type zinc finger |
CDD | cd00021 | 2.60E-5 | 3 | 47 | No hit | No description |
SMART | SM00336 | 2.1E-9 | 4 | 47 | IPR000315 | B-box-type zinc finger |
Pfam | PF00643 | 5.1E-6 | 4 | 47 | IPR000315 | B-box-type zinc finger |
SMART | SM00336 | 4.5E-14 | 53 | 100 | IPR000315 | B-box-type zinc finger |
PROSITE profile | PS50119 | 9.271 | 53 | 100 | IPR000315 | B-box-type zinc finger |
Pfam | PF00643 | 8.1E-7 | 54 | 96 | IPR000315 | B-box-type zinc finger |
CDD | cd00021 | 2.67E-6 | 56 | 86 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005622 | Cellular Component | intracellular | ||||
GO:0008270 | Molecular Function | zinc ion binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 159 aa Download sequence Send to blast |
MKIQCDACEG AAATVVCCAD EAALCARCDV EIHAANKLAS KHQRLPLEAL SATKLPRCDV 60 CQEKAAFIFC VEDRALFCRD CDEPVHVPGT LFGNHQRYLA TGIRVGFASA SACSDGACDA 120 PRTPDHHRPR LKANRLEPTP LXNAPXRFSG PAGGQARGW |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Sof.10633 | 0.0 | callus| crown| inflorescence| leaf| meristem| seed| stem |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: High expression in leaves and lower in roots and flowers. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Acts as negative regulator of seedling photomorphogenesis and light-regulated inhibition of hypocotyl elongation (PubMed:17605755, PubMed:18540109, PubMed:21685177). BBX24/STO and BBX25/STH function as transcriptional corepressors of HY5 activity, leading to the down-regulation of BBX22 expression. BBX24/STO acts additively with BBX25/STH during de-etiolation and the hypocotyl shade avoidance response (PubMed:23624715). Functions as negative regulator of photomorphogenic UV-B responses by interacting with both COP1 and HY5 (PubMed:22410790). May act as a transcription factor in the salt-stress response (PubMed:12909688). {ECO:0000269|PubMed:12909688, ECO:0000269|PubMed:17605755, ECO:0000269|PubMed:18540109, ECO:0000269|PubMed:21685177, ECO:0000269|PubMed:22410790, ECO:0000269|PubMed:23624715}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Circadian regulation with a peak before dawn. {ECO:0000269|PubMed:17605755}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002454143.1 | 1e-75 | B-box zinc finger protein 24 | ||||
Swissprot | Q96288 | 3e-53 | BBX24_ARATH; B-box zinc finger protein 24 | ||||
TrEMBL | C5XX80 | 3e-74 | C5XX80_SORBI; Uncharacterized protein | ||||
STRING | Sb04g025400.1 | 5e-75 | (Sorghum bicolor) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G06040.2 | 3e-56 | DBB family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|