PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Sof017936 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 166aa MW: 18152.5 Da PI: 10.9967 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 101.6 | 7.1e-32 | 29 | 101 | 1 | 73 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPv 73 +CaaCk+lrrk +++Cv+apyfp e+pkkfanvhk+FGasnv+kllk+l +++reda+ssl+y+Aear+ dP Sof017936 29 PCAACKFLRRKVPPGCVFAPYFPPEEPKKFANVHKVFGASNVTKLLKELLPHQREDAVSSLAYQAEARVMDPG 101 7***********************************************************************5 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 19.712 | 28 | 130 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 1.6E-30 | 29 | 100 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 166 aa Download sequence Send to blast |
MASPSSTSNN SALSPVAASG TTTPGAGAPC AACKFLRRKV PPGCVFAPYF PPEEPKKFAN 60 VHKVFGASNV TKLLKELLPH QREDAVSSLA YQAEARVMDP GLRLRRRHLR ASKARDNRLQ 120 KEADPRPRRA SSITPAETID DVIHNRASRS KCRPKAFHGI EQNQPX |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 2e-47 | 22 | 124 | 4 | 105 | LOB family transfactor Ramosa2.1 |
5ly0_B | 2e-47 | 22 | 124 | 4 | 105 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Sof.5058 | 0.0 | crown| inflorescence |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in a band of cells at the adaxial base of all lateral organs formed from the shoot apical meristem and at the base of lateral roots. {ECO:0000269|PubMed:12068116}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Not known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025818403.1 | 8e-62 | protein LATERAL ORGAN BOUNDARIES-like | ||||
Refseq | XP_025818404.1 | 8e-62 | protein LATERAL ORGAN BOUNDARIES-like | ||||
Swissprot | Q9FML4 | 7e-42 | LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES | ||||
TrEMBL | A0A2S3HY84 | 2e-60 | A0A2S3HY84_9POAL; Uncharacterized protein | ||||
TrEMBL | A0A2T7DRP8 | 2e-60 | A0A2T7DRP8_9POAL; Uncharacterized protein | ||||
TrEMBL | A0A3L6SKA6 | 2e-60 | A0A3L6SKA6_PANMI; LOB domain-containing protein 4-like | ||||
STRING | Pavir.J38993.1.p | 1e-60 | (Panicum virgatum) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G63090.4 | 6e-40 | LBD family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|