PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Sof017589 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
|
||||||||
Family | YABBY | ||||||||
Protein Properties | Length: 171aa MW: 19064.9 Da PI: 9.051 | ||||||||
Description | YABBY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | YABBY | 59 | 2.1e-18 | 1 | 48 | 1 | 48 |
YABBY 1 advfssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsv 48 +d++s+se++Cyv+C++Cnt+lav vP ++l+ +vtv+CGhC +l + Sof017589 1 MDMVSQSEHLCYVRCTYCNTVLAVGVPCKTLMDTVTVKCGHCNNLSYL 48 57899**************************************98554 PP | |||||||
2 | YABBY | 89.9 | 6.5e-28 | 87 | 147 | 102 | 162 |
YABBY 102 senedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWah 162 s ++e +pr+p v++PPek+ r Psaynrf++eeiqri a+ Pdi hreafs+aaknWa Sof017589 87 SPTSTELSPRMPFVVKPPEKKHRLPSAYNRFMREEIQRIXAAKPDIPHREAFSMAAKNWAS 147 556778899**************************************************96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04690 | 1.4E-45 | 6 | 147 | IPR006780 | YABBY protein |
SuperFamily | SSF47095 | 1.31E-8 | 90 | 153 | IPR009071 | High mobility group box domain |
Gene3D | G3DSA:1.10.30.10 | 1.3E-5 | 102 | 154 | IPR009071 | High mobility group box domain |
CDD | cd00084 | 1.96E-4 | 109 | 153 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0007275 | Biological Process | multicellular organism development |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 171 aa Download sequence Send to blast |
MDMVSQSEHL CYVRCTYCNT VLAVGVPCKT LMDTVTVKCG HCNNLSYLSP RPPMVQPLSS 60 TDHPLGPFQC QGPCNECGRN QPLPLASPTS TELSPRMPFV VKPPEKKHRL PSAYNRFMRE 120 EIQRIXAAKP DIPHREAFSM AAKNWASATR AARRDCSAAL HSVRPKWPLS V |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Sof.4755 | 0.0 | inflorescence| leaf| seed |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Detected during flower and leaf development. Expression in the flower meristem in the early stage of flower development. When carpel primordia begin to form, specific and uniform expression in carpel primordia. Expression in the central region of the leaf plastochron 1 (P1) primordia. Detected up to P4 stage, hardly detected in the P5 leaves. {ECO:0000269|PubMed:14729915}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Regulates carpel specification in flower development. Severe or intermediate mutation in DL causes complete or partial homeotic conversion of carpels into stamens without affecting the identities of other floral organs. Interacts antagonistically with class B genes and controls floral meristem determinacy. Regulates midrib formation in leaves probably by inducing cell proliferation in the central region of the leaf. {ECO:0000269|PubMed:14729915}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002468276.1 | 1e-102 | protein DROOPING LEAF isoform X2 | ||||
Swissprot | Q76EJ0 | 5e-92 | YABDL_ORYSJ; Protein DROOPING LEAF | ||||
TrEMBL | C5NS03 | 1e-101 | C5NS03_SORBI; DL related protein | ||||
STRING | Sb01g042850.1 | 1e-101 | (Sorghum bicolor) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G69180.1 | 2e-50 | YABBY family protein |