PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|
TF ID | Sof005766 | ||||||||||||
Organism | |||||||||||||
Taxonomic ID | |||||||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
|
||||||||||||
Family | HSF | ||||||||||||
Protein Properties | Length: 94aa MW: 10020.3 Da PI: 3.8571 | ||||||||||||
Description | HSF family protein | ||||||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | HSF_DNA-bind | 30.5 | 9.4e-10 | 52 | 88 | 2 | 38 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHH CS HSF_DNA-bind 2 Flkklyeiledeelkeliswsengnsfvvldeeefak 38 Fl+k+y++++d++++ +sw++++nsfvv+d++ f + Sof005766 52 FLTKTYDMVDDPSTNPDVSWNATNNSFVVWDPHAFFT 88 9********************999**********987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.10 | 9.3E-11 | 46 | 92 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
SuperFamily | SSF46785 | 2.04E-9 | 49 | 91 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
Pfam | PF00447 | 6.1E-7 | 52 | 90 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 94 aa Download sequence Send to blast |
MDPMVNPVKE ESHGEGGDLL AGTEEAGDGP SSAVAAAPRP MEGLHEPXPX PFLTKTYDMV 60 DDPSTNPDVS WNATNNSFVV WDPHAFFTVL VPGX |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Sof.9856 | 1e-153 | inflorescence| meristem| stem |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional regulator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000250}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By heat stress. {ECO:0000269|PubMed:18064488}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002459419.1 | 4e-49 | heat stress transcription factor A-2b | ||||
Swissprot | Q6VBB2 | 2e-28 | HFA2B_ORYSJ; Heat stress transcription factor A-2b | ||||
TrEMBL | C5XB03 | 9e-48 | C5XB03_SORBI; Uncharacterized protein | ||||
STRING | Sb02g004370.1 | 2e-48 | (Sorghum bicolor) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G22830.1 | 2e-22 | heat shock transcription factor A6B |
Publications ? help Back to Top | |||
---|---|---|---|
|