PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|
TF ID | Sof003275 | ||||||||||||
Organism | |||||||||||||
Taxonomic ID | |||||||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
|
||||||||||||
Family | MIKC_MADS | ||||||||||||
Protein Properties | Length: 253aa MW: 28539.3 Da PI: 8.22 | ||||||||||||
Description | MIKC_MADS family protein | ||||||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 99.9 | 1e-31 | 10 | 59 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 rienk+nrqvtfskRrng+lKKA+E+SvLCdaeva+i+fs++gklyeyss Sof003275 10 RIENKINRQVTFSKRRNGLLKKAHEISVLCDAEVALIVFSTKGKLYEYSS 59 8***********************************************96 PP | |||||||
2 | K-box | 98 | 1.4e-32 | 86 | 172 | 12 | 98 |
K-box 12 akaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 ++++ + e+ +Lk++++ Lq++qRhllGe+L+sL++keLqqLeqqL++slk+iRs+Kn+l++++i+elqkkek+l ++n L+k + Sof003275 86 EDQADWGDEYVRLKSKLDALQKSQRHLLGEQLDSLTIKELQQLEQQLDSSLKHIRSRKNQLMFDSISELQKKEKALTDQNGVLQKLM 172 5678999*************************************************************************9998755 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 31.188 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 1.2E-37 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 3.14E-42 | 2 | 74 | No hit | No description |
PRINTS | PR00404 | 5.4E-30 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.57E-32 | 4 | 85 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 3.5E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.4E-30 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.4E-30 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 1.0E-29 | 87 | 171 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 16.121 | 88 | 179 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 253 aa Download sequence Send to blast |
MGSGPVQLRR IENKINRQVT FSKRRNGLLK KAHEISVLCD AEVALIVFST KGKLYEYSSH 60 SSMEGILERY QRYSFEERAV LDPSIEDQAD WGDEYVRLKS KLDALQKSQR HLLGEQLDSL 120 TIKELQQLEQ QLDSSLKHIR SRKNQLMFDS ISELQKKEKA LTDQNGVLQK LMEAEKEKNN 180 ALMNAHLREQ QNGASTSSPS LSPPMVPDSM PTLNIGSCQP RGPGESEPEP SPAPVQANSG 240 NLPPWMLRTV SNR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6byy_A | 8e-21 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6byy_B | 8e-21 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6byy_C | 8e-21 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6byy_D | 8e-21 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_A | 9e-21 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_B | 9e-21 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_C | 9e-21 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_D | 9e-21 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Sof.8689 | 0.0 | inflorescence| leaf| meristem| seed |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Not expressed at early stages of plant development. First detected in leaves 4 weeks after germination, and expression levels are increased when the plant reaches the reproductive stage. {ECO:0000269|PubMed:15299121}. | |||||
Uniprot | TISSUE SPECIFICITY: Widely expressed. Transcripts accumulate to higher levels in organs that retain meristematic characteristics: in the apical meristem and in the meristematic leaf primordia formed on its flank; in the developing panicle at the early stage of rachis-branch primordia differentiation; in the procambium of the rachis branches and in all floral organ primordia. {ECO:0000269|PubMed:10814814}. | |||||
Uniprot | TISSUE SPECIFICITY: Widely expressed. Transcripts accumulate to higher levels in organs that retain meristematic characteristics: in the apical meristem and in the meristematic leaf primordia formed on its flank; in the developing panicle at the early stage of rachis-branch primordia differentiation; in the procambium of the rachis branches and in all floral organ primordia. {ECO:0000269|PubMed:11971906, ECO:0000269|PubMed:15299121}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. | |||||
UniProt | Probable transcription factor that may promote floral transition phase and differentiation program of the vegetative shoot. {ECO:0000269|PubMed:11971906, ECO:0000269|PubMed:15299121}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002460989.1 | 1e-168 | MADS-box transcription factor 18 | ||||
Swissprot | A2YNI2 | 1e-137 | MAD18_ORYSI; MADS-box transcription factor 18 | ||||
Swissprot | Q0D4T4 | 1e-137 | MAD18_ORYSJ; MADS-box transcription factor 18 | ||||
TrEMBL | C5XDW7 | 1e-167 | C5XDW7_SORBI; Uncharacterized protein | ||||
STRING | Sb02g038780.1 | 1e-168 | (Sorghum bicolor) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G69120.1 | 5e-71 | MIKC_MADS family protein |