PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 98669 | ||||||||
Common Name | SELMODRAFT_127220, SELMODRAFT_98669 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 128aa MW: 14605.9 Da PI: 10.3653 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 56.3 | 7.5e-18 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT+eEd ll + ++q+G g+W++ ++ g+ R++k+c++rw +yl 98669 14 RGPWTPEEDMLLTKHIEQHGEGNWRALPKAAGLLRCGKSCRLRWVNYL 61 89******************************99************97 PP | |||||||
2 | Myb_DNA-binding | 55.3 | 1.5e-17 | 67 | 112 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+ +++E++l++ ++++lG++ W++Ia++m+ gRt++++k++w+++l 98669 67 RGNISEDEEDLIIMLHALLGNR-WSLIAARMP-GRTDNEIKNYWNTHL 112 7899******************.*********.************996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 14.426 | 9 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 4.03E-31 | 11 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.4E-14 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.9E-16 | 14 | 61 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 5.5E-24 | 15 | 68 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.69E-11 | 16 | 61 | No hit | No description |
PROSITE profile | PS51294 | 25.793 | 62 | 116 | IPR017930 | Myb domain |
SMART | SM00717 | 2.2E-16 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.4E-16 | 67 | 112 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 6.1E-26 | 69 | 116 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 7.24E-12 | 71 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009751 | Biological Process | response to salicylic acid | ||||
GO:0009753 | Biological Process | response to jasmonic acid | ||||
GO:0009909 | Biological Process | regulation of flower development | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 128 aa Download sequence Send to blast |
MGRAPCCSKV GLNRGPWTPE EDMLLTKHIE QHGEGNWRAL PKAAGLLRCG KSCRLRWVNY 60 LRPNVKRGNI SEDEEDLIIM LHALLGNRWS LIAARMPGRT DNEIKNYWNT HLSKKLASRG 120 LDPKTHKP |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 9e-28 | 12 | 116 | 25 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that may play a role in flower development by repressing ANT (PubMed:19232308). Regulates the transition of meristem identity from vegetative growth to flowering. Acts downstream of LFY and upstream of AP1. Directly activates AP1 to promote floral fate. Together with LFY and AP1 may constitute a regulatory network that contributes to an abrupt and robust meristem identity transition (PubMed:21750030). {ECO:0000269|PubMed:19232308, ECO:0000269|PubMed:21750030}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00114 | ampDAP | Transfer from AT3G61250 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002972896.2 | 3e-90 | myb-related protein 306 | ||||
Refseq | XP_002988033.2 | 2e-90 | myb-related protein 306 | ||||
Swissprot | Q9M2D9 | 6e-67 | MYB17_ARATH; Transcription factor MYB17 | ||||
TrEMBL | D8RNQ0 | 3e-89 | D8RNQ0_SELML; Uncharacterized protein (Fragment) | ||||
STRING | EFJ10825 | 6e-90 | (Selaginella moellendorffii) | ||||
STRING | EFJ26117 | 6e-90 | (Selaginella moellendorffii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP5 | 17 | 1784 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G61250.1 | 3e-69 | myb domain protein 17 |
Link Out ? help Back to Top | |
---|---|
Phytozome | 98669 |
Entrez Gene | 9636489 | 9656764 |
Publications ? help Back to Top | |||
---|---|---|---|
|