PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 93174 | ||||||||
Common Name | MADS9-1, SELMODRAFT_450769 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 60aa MW: 7038.29 Da PI: 10.7863 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 44.4 | 2.1e-14 | 17 | 54 | 9 | 46 |
HHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEE CS SRF-TF 9 rqvtfskRrngilKKAeELSvLCdaevaviifsstgkl 46 r+ tf kR +g++KKA EL vLC+a+v v ++ +gk 93174 17 RTQTFRKRTEGLFKKAIELQVLCGAKVEVTVIYDSGKK 54 778*********************98877666666554 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 19.764 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 1.1E-13 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 6.15E-19 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00120 | 2.59E-15 | 2 | 60 | No hit | No description |
PRINTS | PR00404 | 5.3E-12 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 5.4E-14 | 16 | 55 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.3E-12 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.3E-12 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 60 aa Download sequence Send to blast |
MGRRKIDIKY LVKNNPRTQT FRKRTEGLFK KAIELQVLCG AKVEVTVIYD SGKKHFFYSS |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002970519.1 | 1e-37 | serum factor response D | ||||
Refseq | XP_002978603.1 | 1e-37 | serum factor response D | ||||
TrEMBL | D8RGU6 | 3e-36 | D8RGU6_SELML; MADS-domain transcription factor | ||||
TrEMBL | D8S5G0 | 2e-36 | D8S5G0_SELML; MADS-domain transcription factor | ||||
STRING | EFJ20589 | 4e-37 | (Selaginella moellendorffii) | ||||
STRING | EFJ28649 | 5e-37 | (Selaginella moellendorffii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP16 | 17 | 761 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G13790.1 | 9e-12 | AGAMOUS-like 15 |
Link Out ? help Back to Top | |
---|---|
Phytozome | 93174 |
Entrez Gene | 9631738 |
Publications ? help Back to Top | |||
---|---|---|---|
|