PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 90153
Common NameSELMODRAFT_90153
Organism
Selaginella moellendorffii
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family MYB_related
Protein Properties Length: 87aa    MW: 10042.8 Da    PI: 10.0929
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
90153genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.71.6e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+lv++++++G g+W+++++  g+ R++k+c++rw +yl
            90153 14 KGLWSPEEDEKLVRYITKYGHGCWSAVPKQAGLQRCGKSCRLRWINYL 61
                     678*******************************************97 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.0E-29664IPR009057Homeodomain-like
PROSITE profilePS5129425.43965IPR017930Myb domain
SMARTSM007174.6E-141363IPR001005SANT/Myb domain
PfamPF002492.6E-171461IPR001005SANT/Myb domain
SuperFamilySSF466891.68E-221687IPR009057Homeodomain-like
CDDcd001671.01E-111761No hitNo description
Gene3DG3DSA:1.10.10.606.5E-76587IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 87 aa     Download sequence    Send to blast
MGRHSCCQKQ KLKKGLWSPE EDEKLVRYIT KYGHGCWSAV PKQAGLQRCG KSCRLRWINY  60
LRPDLKRGVF SATEEKLIIE LHAVLGN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-151287579B-MYB
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that coordinates a small network of downstream target genes required for several aspects of plant growth and development, such as xylem formation and xylem cell differentiation, and lateral root formation (PubMed:22708996). Regulates a specific set of target genes by binding DNA to the AC cis-element 5'-ACCTAC-3' (PubMed:23741471). Functions as a transcriptional regulator of stomatal closure. Plays a role the regulation of stomatal pore size independently of abscisic acid (ABA) (PubMed:16005292). Required for seed coat mucilage deposition during the development of the seed coat epidermis (PubMed:19401413). Involved in the induction of trichome initiation and branching by positively regulating GL1 and GL2. Required for gibberellin (GA) biosynthesis and degradation by positively affecting the expression of the enzymes that convert GA9 into the bioactive GA4, as well as the enzymes involved in the degradation of GA4 (PubMed:28207974). {ECO:0000269|PubMed:16005292, ECO:0000269|PubMed:19401413, ECO:0000269|PubMed:22708996, ECO:0000269|PubMed:23741471, ECO:0000269|PubMed:28207974}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002968634.26e-58transcription factor MYB41 isoform X2
RefseqXP_024519528.16e-58transcription factor MYB20-like
SwissprotQ8VZQ27e-52MYB61_ARATH; Transcription factor MYB61
TrEMBLA0A2K1J3323e-54A0A2K1J332_PHYPA; Uncharacterized protein
TrEMBLA5JYF22e-54A5JYF2_PICGL; R2R3-MYB transcription factor MYB8
TrEMBLD8RDI47e-58D8RDI4_SELML; Uncharacterized protein (Fragment)
STRINGPP1S277_14V6.15e-55(Physcomitrella patens)
STRINGEFJ297501e-58(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01680.34e-57myb domain protein 55
Publications ? help Back to Top
  1. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]
  2. Heyndrickx KS,Vandepoele K
    Systematic identification of functional plant modules through the integration of complementary data sources.
    Plant Physiol., 2012. 159(3): p. 884-901
    [PMID:22589469]
  3. Matías-Hernández L, et al.
    AaMYB1 and its orthologue AtMYB61 affect terpene metabolism and trichome development in Artemisia annua and Arabidopsis thaliana.
    Plant J., 2017. 90(3): p. 520-534
    [PMID:28207974]