PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 84611
Common NameSELMODRAFT_451357, WOX9-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family WOX
Protein Properties Length: 89aa    MW: 10688 Da    PI: 9.8361
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
84611genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox52.96.2e-172787257
              T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
  Homeobox  2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
              + R+++++eql+ L +lFe+    +++++++e+A  l    ++te++V +WF+Nr+a+ k+
     84611 27 KVRWKPNEEQLRMLVRLFEEeGDSINKQRIKEIAVDLarqgDVTEANVHNWFHNRKARAKR 87
              67*****************989*************************************97 PP

2Wus_type_Homeobox67.81.9e-222789365
  Wus_type_Homeobox  3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                       + RW P++eQ+++L +l+++   + nk++i++i+  L++ G ++++NV++WF NrkaR ++kq
              84611 27 KVRWKPNEEQLRMLVRLFEEEGDSINKQRIKEIAVDLARQGDVTEANVHNWFHNRKARAKRKQ 89
                       68******************99***************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007111.6292388IPR001356Homeobox domain
SuperFamilySSF466896.94E-122588IPR009057Homeodomain-like
CDDcd000863.37E-52789No hitNo description
PfamPF000461.4E-142787IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.2E-102888IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 89 aa     Download sequence    Send to blast
MEESHYQQQQ QQQQQQALQE LPPAVVKVRW KPNEEQLRML VRLFEEEGDS INKQRIKEIA  60
VDLARQGDVT EANVHNWFHN RKARAKRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024526432.11e-53ecdysone-induced protein 74EF isoform X1
RefseqXP_024526433.11e-53ecdysone-induced protein 74EF isoform X2
TrEMBLD8R3X47e-56D8R3X4_SELML; Uncharacterized protein WOX9-1
STRINGEFJ333621e-56(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP18731639
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20700.13e-19WUSCHEL related homeobox 14
Publications ? help Back to Top
  1. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]