PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 84608 | ||||||||
Common Name | SELMODRAFT_84608, SELMODRAFT_89380 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 89aa MW: 10298.9 Da PI: 9.9125 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 59.9 | 5.7e-19 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g W++eEde+lv++++++G +W+t+++ g+ R++k+c++rw +yl 84608 14 KGLWSPEEDEKLVRYITKYGHSCWSTVPEQAGLQRCGKSCRLRWINYL 61 678*******************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 1.2E-28 | 6 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 24.441 | 9 | 65 | IPR017930 | Myb domain |
SMART | SM00717 | 4.7E-13 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.4E-16 | 14 | 61 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 3.13E-22 | 16 | 88 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.38E-10 | 17 | 61 | No hit | No description |
PROSITE profile | PS50090 | 4.019 | 62 | 88 | IPR017877 | Myb-like domain |
Gene3D | G3DSA:1.10.10.60 | 2.4E-8 | 65 | 88 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 89 aa Download sequence Send to blast |
MGRHSCCQKQ KLKKGLWSPE EDEKLVRYIT KYGHSCWSTV PEQAGLQRCG KSCRLRWINY 60 LRPDLKRGNF TSHEEKLIID LHAALGNR* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 8e-16 | 12 | 88 | 5 | 80 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002965582.2 | 2e-59 | myb-like protein Q | ||||
Refseq | XP_002968061.2 | 2e-59 | myb-like protein Q | ||||
Swissprot | Q8LPH6 | 7e-49 | MYB86_ARATH; Transcription factor MYB86 | ||||
TrEMBL | D8R3U9 | 2e-59 | D8R3U9_SELML; Uncharacterized protein | ||||
STRING | EFJ30315 | 4e-60 | (Selaginella moellendorffii) | ||||
STRING | EFJ33002 | 4e-60 | (Selaginella moellendorffii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP5 | 17 | 1784 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G01680.3 | 2e-54 | myb domain protein 55 |
Link Out ? help Back to Top | |
---|---|
Phytozome | 84608 |
Entrez Gene | 9631147 | 9634634 |
Publications ? help Back to Top | |||
---|---|---|---|
|