PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 80553 | ||||||||
Common Name | SELMODRAFT_127613 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 138aa MW: 16302.5 Da PI: 10.5326 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 56.1 | 8.3e-18 | 23 | 68 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg W + Ede+l+++v+ +G+ +W+ Ia+++ gR++k+c++rw++ 80553 23 RGHWRPAEDEKLKELVRIHGPQNWNVIAEKLE-GRSGKSCRLRWFNQ 68 899*****************************.***********996 PP | |||||||
2 | Myb_DNA-binding | 60 | 5e-19 | 75 | 119 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 r+++++eE+e+l+ a++++G++ W+ Iar ++ gRt++ +k++w+ + 80553 75 RKPFSEEEEERLLAAHQLHGNK-WAMIARIFP-GRTDNAVKNHWHVV 119 789*******************.*********.***********976 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 17.399 | 18 | 69 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.03E-29 | 22 | 116 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 7.9E-15 | 22 | 71 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 6.2E-17 | 23 | 68 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.3E-26 | 24 | 76 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.42E-12 | 26 | 67 | No hit | No description |
PROSITE profile | PS51294 | 27.073 | 70 | 124 | IPR017930 | Myb domain |
SMART | SM00717 | 1.3E-15 | 74 | 122 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.5E-15 | 75 | 118 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.8E-22 | 77 | 124 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.30E-6 | 86 | 120 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 138 aa Download sequence Send to blast |
MNDESENSVD RDADCSQSKL CHRGHWRPAE DEKLKELVRI HGPQNWNVIA EKLEGRSGKS 60 CRLRWFNQLD PRINRKPFSE EEEERLLAAH QLHGNKWAMI ARIFPGRTDN AVKNHWHVVM 120 ARKLRERSRM QGRKKSQA |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 7e-32 | 23 | 124 | 7 | 108 | B-MYB |
Search in ModeBase |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 122 | 134 | KLRERSRMQGRKK |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that involved in boundary specification, meristem initiation and maintenance, and organ patterning. Functions in both lateral organ separation and axillary meristem formation. {ECO:0000269|PubMed:19542355}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024517762.1 | 3e-98 | myb-like protein Q | ||||
Swissprot | Q9SEZ4 | 1e-65 | MY105_ARATH; Transcription factor MYB105 | ||||
TrEMBL | D8SXZ5 | 2e-97 | D8SXZ5_SELML; Uncharacterized protein | ||||
STRING | EFJ10706 | 3e-98 | (Selaginella moellendorffii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP5 | 17 | 1784 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G69560.1 | 6e-68 | myb domain protein 105 |
Link Out ? help Back to Top | |
---|---|
Phytozome | 80553 |
Entrez Gene | 9662676 |
Publications ? help Back to Top | |||
---|---|---|---|
|