PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

80215

Common Name

DUO1B-1, SELMODRAFT_80215

Organism

Selaginella moellendorffii

Taxonomic ID

88036

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella

Family

MYB_related

Protein Properties

Length: 90aa MW: 10575.3 Da PI: 10.2596

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
80215	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	46.4	9.4e-15	14	59	1	46
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 +g+W +eEde l+++v+q+G+++W++I ++ + Rt+k+c++rw + 80215 14 KGPWMPEEDEVLLEYVRQYGPRDWSSIRSKGLLPRTGKSCRLRWVN 59 79***********************8876677********87 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	20.482	9	65	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	2.5E-21	12	67	IPR009057	Homeodomain-like
SMART	SM00717	1.2E-11	13	63	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	3.55E-18	13	90	IPR009057	Homeodomain-like
CDD	cd00167	1.74E-11	16	61	No hit	No description
Pfam	PF13921	1.1E-13	17	80	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 90 aa Download sequence Send to blast
MQHQQGGDQV VLRKGPWMPE EDEVLLEYVR QYGPRDWSSI RSKGLLPRTG KSCRLRWVNK 60 LKPDLKRYLG CKFSPEEEKM VVKMQSKLGN

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h8a_C	9e-17	12	90	25	99	MYB TRANSFORMING PROTEIN
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor. {ECO:0000305}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_024524157.1	8e-54	transcription repressor MYB4
Swissprot	Q0JB89	2e-36	MYB58_ORYSJ; Probable transcription factor MYB58
TrEMBL	D8QY18	3e-59	D8QY18_SELML; Uncharacterized protein DUO1B-1 (Fragment)
STRING	EFJ35126	6e-60	(Selaginella moellendorffii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP5	17	1784

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G60460.1	2e-36	MYB family protein

Link Out ? help Back to Top
Phytozome	80215
Entrez Gene	9643465

Publications ? help Back to Top
Yilmaz A, et al. GRASSIUS: a platform for comparative regulatory genomics across the grasses. Plant Physiol., 2009. 149(1): p. 171-80 [PMID:18987217] Banks JA, et al. The Selaginella genome identifies genetic changes associated with the evolution of vascular plants. Science, 2011. 332(6032): p. 960-3 [PMID:21551031]