PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 79699 | ||||||||
Common Name | SELMODRAFT_79699 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 87aa MW: 10112.5 Da PI: 9.2449 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 130.6 | 5.5e-41 | 8 | 85 | 1 | 78 |
--SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS SBP 1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 +C+v+gC +dls+a +yhrrhkvC+ h+ p+v+ +g+eqrfCqqCsrfh+lsefDe+krsCr+rLa+hnerrr++q+ 79699 8 CCRVDGCGEDLSTAGDYHRRHKVCKLHATLPKVMNHGQEQRFCQQCSRFHSLSEFDEGKRSCRKRLAGHNERRRRHQP 85 6**************************************************************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:4.10.1100.10 | 2.2E-33 | 6 | 70 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 30.983 | 6 | 83 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 1.7E-37 | 7 | 86 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 2.5E-32 | 9 | 82 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 87 aa Download sequence Send to blast |
MPVLPVPCCR VDGCGEDLST AGDYHRRHKV CKLHATLPKV MNHGQEQRFC QQCSRFHSLS 60 EFDEGKRSCR KRLAGHNERR RRHQPDS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ul4_A | 5e-29 | 9 | 82 | 11 | 84 | squamosa promoter binding protein-like 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002963433.2 | 5e-57 | squamosa promoter-binding-like protein 15 isoform X1 | ||||
Refseq | XP_024524017.1 | 2e-57 | uncharacterized protein LOC9655427 isoform X2 | ||||
Refseq | XP_024524018.1 | 2e-57 | uncharacterized protein LOC9655427 isoform X3 | ||||
Swissprot | Q700C2 | 1e-32 | SPL16_ARATH; Squamosa promoter-binding-like protein 16 | ||||
TrEMBL | D8QWW0 | 1e-57 | D8QWW0_SELML; Uncharacterized protein (Fragment) | ||||
STRING | EFJ35304 | 2e-58 | (Selaginella moellendorffii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP97 | 17 | 230 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G76580.1 | 6e-35 | SBP family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | 79699 |
Entrez Gene | 9655427 |
Publications ? help Back to Top | |||
---|---|---|---|
|