PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 78396 | ||||||||
Common Name | SELMODRAFT_78396, SELMODRAFT_79245 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 84aa MW: 10176.5 Da PI: 7.2536 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 30.4 | 8.9e-10 | 35 | 76 | 3 | 46 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 +WT+eE +l++d ++++ ++ +++Ia+ ++ ++t +c+++++ 78396 35 PWTPEEKKLFLDKFALFYKN-FAKIASFLQ-HKTTGDCVEFYYR 76 8*****************99.*********.***********86 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF46689 | 1.12E-15 | 20 | 82 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51293 | 17.257 | 31 | 82 | IPR017884 | SANT domain |
SMART | SM00717 | 5.7E-9 | 32 | 80 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.2E-7 | 34 | 76 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.3E-6 | 34 | 79 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 84 aa Download sequence Send to blast |
MILCQGERSA QYIVQSNRRV EDPIEFEQER KSINPWTPEE KKLFLDKFAL FYKNFAKIAS 60 FLQHKTTGDC VEFYYRNQKT EEFQ |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024515239.1 | 5e-50 | uncharacterized protein LOC112340639 isoform X1 | ||||
Refseq | XP_024515243.1 | 5e-50 | uncharacterized protein LOC112340639 isoform X2 | ||||
Refseq | XP_024517706.1 | 5e-50 | uncharacterized protein LOC9660995 isoform X1 | ||||
Refseq | XP_024517711.1 | 4e-50 | uncharacterized protein LOC9660995 isoform X2 | ||||
TrEMBL | D8QU31 | 5e-56 | D8QU31_SELML; Uncharacterized protein (Fragment) | ||||
STRING | EFJ35990 | 9e-57 | (Selaginella moellendorffii) | ||||
STRING | EFJ36228 | 9e-57 | (Selaginella moellendorffii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP3215 | 17 | 25 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G52250.1 | 2e-24 | MYB family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | 78396 |
Entrez Gene | 9661125 | 9661764 |
Publications ? help Back to Top | |||
---|---|---|---|
|