PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 73117 | ||||||||
Common Name | SELMODRAFT_73117 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
|
||||||||
Family | Nin-like | ||||||||
Protein Properties | Length: 54aa MW: 6387.62 Da PI: 10.4858 | ||||||||
Description | Nin-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | RWP-RK | 73.6 | 2.6e-23 | 1 | 48 | 5 | 52 |
RWP-RK 5 isledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 isledls+yF + i++A+keL+v+ TvLK++C ++GI+ WPhRk+ksl 73117 1 ISLEDLSRYFTMLITQASKELKVSRTVLKKRCCEFGIPQWPHRKLKSL 48 89********************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF02042 | 8.4E-21 | 1 | 48 | IPR003035 | RWP-RK domain |
PROSITE profile | PS51519 | 15.767 | 1 | 54 | IPR003035 | RWP-RK domain |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 54 aa Download sequence Send to blast |
ISLEDLSRYF TMLITQASKE LKVSRTVLKK RCCEFGIPQW PHRKLKSLES LIHK |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Putative transcription factor. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002970926.2 | 2e-32 | protein RKD1 | ||||
Swissprot | O81791 | 4e-18 | RKD5_ARATH; Protein RKD5 | ||||
TrEMBL | D8RII2 | 4e-31 | D8RII2_SELML; Uncharacterized protein (Fragment) | ||||
STRING | EFJ28252 | 6e-32 | (Selaginella moellendorffii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP567 | 17 | 77 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G35590.1 | 2e-20 | RWP-RK domain-containing protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | 73117 |
Entrez Gene | 9633195 |
Publications ? help Back to Top | |||
---|---|---|---|
|