PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 69566 | ||||||||
Common Name | SELMODRAFT_69566, SELMODRAFT_69567 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 67aa MW: 7606.78 Da PI: 11.3093 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 64.6 | 1.1e-20 | 3 | 37 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 Cs+C+t kTp+WR gp g+ktLCnaCG+++++ +l 69566 3 CSHCQTQKTPQWRAGPLGPKTLCNACGVRFKSGRL 37 *******************************9986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00401 | 7.1E-13 | 1 | 47 | IPR000679 | Zinc finger, GATA-type |
PROSITE profile | PS50114 | 12.004 | 1 | 33 | IPR000679 | Zinc finger, GATA-type |
Gene3D | G3DSA:3.30.50.10 | 5.1E-16 | 1 | 35 | IPR013088 | Zinc finger, NHR/GATA-type |
SuperFamily | SSF57716 | 1.43E-15 | 2 | 61 | No hit | No description |
CDD | cd00202 | 9.69E-12 | 2 | 49 | No hit | No description |
PROSITE pattern | PS00344 | 0 | 3 | 28 | IPR000679 | Zinc finger, GATA-type |
Pfam | PF00320 | 2.5E-18 | 3 | 37 | IPR000679 | Zinc finger, GATA-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0007623 | Biological Process | circadian rhythm | ||||
GO:0009416 | Biological Process | response to light stimulus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 67 aa Download sequence Send to blast |
RKCSHCQTQK TPQWRAGPLG PKTLCNACGV RFKSGRLLPE YRPAGSPSFV SDKHSNSHRK 60 VLEMRRQ |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). {ECO:0000250}. | |||||
UniProt | Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). Transcription activator involved in xylem formation. Functions upstream of NAC030/VND7, a master switch of xylem vessel differentiation (PubMed:25265867). {ECO:0000250|UniProtKB:Q8LAU9, ECO:0000269|PubMed:25265867}. | |||||
UniProt | Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes. {ECO:0000269|PubMed:12139008}. | |||||
UniProt | Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes. {ECO:0000269|PubMed:12139008}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00048 | PBM | Transfer from AT4G32890 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024528035.1 | 9e-42 | glutamic acid-rich protein-like | ||||
Refseq | XP_024530641.1 | 1e-41 | glutamic acid-rich protein-like | ||||
Swissprot | O49741 | 3e-35 | GATA2_ARATH; GATA transcription factor 2 | ||||
Swissprot | O49743 | 3e-35 | GATA4_ARATH; GATA transcription factor 4 | ||||
Swissprot | O82632 | 3e-35 | GATA9_ARATH; GATA transcription factor 9 | ||||
Swissprot | P69781 | 6e-35 | GAT12_ARATH; GATA transcription factor 12 | ||||
TrEMBL | D8QND4 | 2e-42 | D8QND4_SELML; Uncharacterized protein (Fragment) | ||||
STRING | EFJ31776 | 3e-43 | (Selaginella moellendorffii) | ||||
STRING | EFJ38082 | 3e-43 | (Selaginella moellendorffii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP68 | 17 | 287 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G60530.1 | 1e-37 | GATA transcription factor 4 |
Link Out ? help Back to Top | |
---|---|
Phytozome | 69566 |
Entrez Gene | 9632562 | 9634388 |
Publications ? help Back to Top | |||
---|---|---|---|
|