PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

69510

Common Name

HANb-1, HANb-2, SELMODRAFT_107936, SELMODRAFT_451362

Organism

Selaginella moellendorffii

Taxonomic ID

88036

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella

Family

GATA

Protein Properties

Length: 59aa MW: 6125.87 Da PI: 10.0217

Description

GATA family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
69510	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	GATA	61.7	9.1e-20	16	50	1	35
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 C++Cg+tkTplWR+gp g+k+LCnaCG++y+k g+ 69510 16 CTQCGATKTPLWRNGPCGPKSLCNACGIRYKKVGS 50 ********************************875 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF57716	4.75E-15	10	53	No hit	No description
PROSITE profile	PS50114	14.417	10	59	IPR000679	Zinc finger, GATA-type
SMART	SM00401	3.5E-13	10	59	IPR000679	Zinc finger, GATA-type
Gene3D	G3DSA:3.30.50.10	1.5E-16	14	50	IPR013088	Zinc finger, NHR/GATA-type
CDD	cd00202	1.11E-11	15	56	No hit	No description
Pfam	PF00320	1.5E-17	16	49	IPR000679	Zinc finger, GATA-type
PROSITE pattern	PS00344	0	16	41	IPR000679	Zinc finger, GATA-type

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0008270	Molecular Function	zinc ion binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 59 aa Download sequence Send to blast
SSSEMSPGAT SPSRSCTQCG ATKTPLWRNG PCGPKSLCNA CGIRYKKVGS TKRTSNSSD

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor that regulates organogenesis during transition from the vegetative to the reproductive phase. Regulates the expression of CYP78A11/PLA1, HD3A and MADS1 during reproductive development in rice. May act upstream of CYP78A11/PLA1 during panicle development. Acts independently of the photoperiodic and gibberellin signaling pathways. {ECO:0000269\|PubMed:19337211}.
UniProt	Transcriptional regulator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. {ECO:0000250}.
UniProt	Transcriptional regulator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. {ECO:0000250}.
UniProt	Transcriptional regulator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. Regulates both flower and shoot apical meristem (SAM) development, especially for establishing organ boundaries in shoots and flowers, probably by controlling the number and position of WUS-expressing cells (PubMed:23335616, PubMed:25077795). {ECO:0000250, ECO:0000269\|PubMed:23335616, ECO:0000269\|PubMed:25077795}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Repressed by HAN. {ECO:0000269\|PubMed:23335616}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002978035.2	2e-34	GATA transcription factor 15
Refseq	XP_024526836.1	2e-34	GATA transcription factor 15
Swissprot	Q6L5E5	1e-12	GAT15_ORYSJ; GATA transcription factor 15
Swissprot	Q6QPM2	9e-13	GAT19_ARATH; GATA transcription factor 19
Swissprot	Q8LG10	6e-13	GAT15_ARATH; GATA transcription factor 15
Swissprot	Q9ZPX0	8e-13	GAT20_ARATH; GATA transcription factor 20
TrEMBL	D8R4U4	4e-33	D8R4U4_SELML; Uncharacterized protein HANb-1
STRING	EFJ20692	7e-34	(Selaginella moellendorffii)
STRING	EFJ32731	7e-34	(Selaginella moellendorffii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP68	17	287

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G06740.1	3e-15	GATA transcription factor 15

Link Out ? help Back to Top
Phytozome	69510
Entrez Gene	9652528 \| 9658148

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Cheng CH, et al. A fine physical map of the rice chromosome 5. Mol. Genet. Genomics, 2005. 274(4): p. 337-45 [PMID:16261349] Banks JA, et al. The Selaginella genome identifies genetic changes associated with the evolution of vascular plants. Science, 2011. 332(6032): p. 960-3 [PMID:21551031] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Behringer C,Bastakis E,Ranftl QL,Mayer KF,Schwechheimer C Functional diversification within the family of B-GATA transcription factors through the leucine-leucine-methionine domain. Plant Physiol., 2014. 166(1): p. 293-305 [PMID:25077795] Ranftl QL,Bastakis E,Klermund C,Schwechheimer C LLM-Domain Containing B-GATA Factors Control Different Aspects of Cytokinin-Regulated Development in Arabidopsis thaliana. Plant Physiol., 2016. 170(4): p. 2295-311 [PMID:26829982]