PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 68988 | ||||||||
Common Name | SELMODRAFT_59324, SELMODRAFT_68988 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 111aa MW: 12345.2 Da PI: 8.4917 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 151.9 | 1.5e-47 | 8 | 107 | 1 | 100 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100 +CaaCk+lrrkC+++Cv+apyfp +qp+kfanvhk+FGasn++kll++lp+++reda++sl+yeA+ar++dPvyG+vg i+ lq+q+++l++ela +++ 68988 8 PCAACKFLRRKCTPECVFAPYFPPDQPHKFANVHKIFGASNITKLLNELPPHQREDAVNSLAYEADARVKDPVYGCVGAISMLQRQVARLQHELAIAQQD 107 7***********************************************************************************************9986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 27.918 | 7 | 108 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 1.6E-46 | 8 | 105 | IPR004883 | Lateral organ boundaries, LOB |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010199 | Biological Process | organ boundary specification between lateral organs and the meristem |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 111 aa Download sequence Send to blast |
MASSSSSPCA ACKFLRRKCT PECVFAPYFP PDQPHKFANV HKIFGASNIT KLLNELPPHQ 60 REDAVNSLAY EADARVKDPV YGCVGAISML QRQVARLQHE LAIAQQDLAR Y |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 1e-61 | 4 | 111 | 7 | 114 | LOB family transfactor Ramosa2.1 |
5ly0_B | 1e-61 | 4 | 111 | 7 | 114 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Not known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00581 | DAP | Transfer from AT5G63090 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024530896.1 | 2e-78 | protein ASYMMETRIC LEAVES 2 | ||||
Refseq | XP_024539311.1 | 3e-78 | protein LATERAL ORGAN BOUNDARIES | ||||
Refseq | XP_024539312.1 | 3e-78 | protein LATERAL ORGAN BOUNDARIES | ||||
Refseq | XP_024539313.1 | 3e-78 | protein LATERAL ORGAN BOUNDARIES | ||||
Refseq | XP_024539314.1 | 3e-78 | protein LATERAL ORGAN BOUNDARIES | ||||
Swissprot | Q9FML4 | 1e-62 | LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES | ||||
TrEMBL | D8RGG9 | 5e-77 | D8RGG9_SELML; Uncharacterized protein (Fragment) | ||||
STRING | EFJ20525 | 9e-78 | (Selaginella moellendorffii) | ||||
STRING | EFJ28594 | 9e-78 | (Selaginella moellendorffii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP60 | 16 | 318 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G63090.4 | 1e-62 | LBD family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | 68988 |
Entrez Gene | 9646608 | 9653478 |
Publications ? help Back to Top | |||
---|---|---|---|
|