PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 68150 | ||||||||
Common Name | SELMODRAFT_58190, SELMODRAFT_68150 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 129aa MW: 15159 Da PI: 9.5464 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 180.7 | 3.7e-56 | 1 | 125 | 2 | 128 |
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkkt 105 ppGfrF+Ptd+elv +yL++kv+g+++++ ++i+evd+yk+ePwdLp k + ++ ewyfFs+rd+ky++g r+nrat++gyWkatgkd++v s +++++g+kkt 68150 1 PPGFRFRPTDQELVGFYLARKVSGRSIQA-NIIAEVDLYKCEPWDLPGKSYVTDVEWYFFSPRDRKYPNGWRTNRATEAGYWKATGKDRTVRS-GSRDIGMKKT 102 89***************************.89***************87788899*************************************9.99******** PP NAM 106 LvfykgrapkgektdWvmheyrl 128 Lvfy+grap+g++tdW+mheyrl 68150 103 LVFYTGRAPHGQRTDWIMHEYRL 125 *********************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51005 | 56.074 | 1 | 129 | IPR003441 | NAC domain |
Pfam | PF02365 | 3.5E-30 | 1 | 125 | IPR003441 | NAC domain |
SuperFamily | SSF101941 | 2.35E-59 | 1 | 128 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 129 aa Download sequence Send to blast |
PPGFRFRPTD QELVGFYLAR KVSGRSIQAN IIAEVDLYKC EPWDLPGKSY VTDVEWYFFS 60 PRDRKYPNGW RTNRATEAGY WKATGKDRTV RSGSRDIGMK KTLVFYTGRA PHGQRTDWIM 120 HEYRLDEDD |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3ulx_A | 1e-53 | 1 | 125 | 16 | 140 | Stress-induced transcription factor NAC1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC045, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00212 | DAP | Transfer from AT1G65910 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | - | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002980786.2 | 1e-91 | NAC domain-containing protein 74 isoform X1 | ||||
Swissprot | Q9FFI5 | 3e-64 | NAC86_ARATH; NAC domain-containing protein 86 | ||||
TrEMBL | D8QTJ0 | 2e-91 | D8QTJ0_SELML; Uncharacterized protein (Fragment) | ||||
STRING | EFJ17971 | 4e-92 | (Selaginella moellendorffii) | ||||
STRING | EFJ37124 | 4e-92 | (Selaginella moellendorffii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP17 | 15 | 800 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G65910.1 | 2e-70 | NAC domain containing protein 28 |
Link Out ? help Back to Top | |
---|---|
Phytozome | 68150 |
Entrez Gene | 9629662 | 9656960 |
Publications ? help Back to Top | |||
---|---|---|---|
|