PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 65512 | ||||||||
Common Name | RR5-1, SELMODRAFT_440049 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
|
||||||||
Family | ARR-B | ||||||||
Protein Properties | Length: 246aa MW: 27823.2 Da PI: 7.8236 | ||||||||
Description | ARR-B family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | G2-like | 86.6 | 2.4e-27 | 186 | 239 | 1 | 55 |
G2-like 1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 k+r++W+ +LH++Fv+a++++ G+ekA+Pk+ile+m+++gLt+e+v+SHLQkYRl 65512 186 KARVVWSFDLHQQFVKAINHI-GIEKAVPKRILEVMNIQGLTRENVASHLQKYRL 239 68*******************.********************************8 PP | |||||||
2 | Response_reg | 86.8 | 6.1e-29 | 6 | 114 | 1 | 109 |
EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS Response_reg 1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 vl+vdD+p + ll+++l++ +y v++++ +++al++l+e++ +D+++ D+ mp+mdG++ll+ i e +p+i+++a+ge + + + + +Ga 65512 6 VLVVDDDPCCLTLLERMLRECKY-AVTTCSRATAALTILRERKesFDVVISDVHMPDMDGFKLLELIGLEM-GIPVIMMSASGETDAVMKGVVYGAC 100 89*********************.***************888888**********************6644.8************************ PP EEEESS--HHHHHH CS Response_reg 96 dflsKpfdpeelvk 109 d+l+Kp+ +eel++ 65512 101 DYLVKPVRIEELRN 114 ************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PIRSF | PIRSF036392 | 1.3E-131 | 1 | 246 | IPR017053 | Response regulator B-type, plant |
SuperFamily | SSF52172 | 1.85E-37 | 2 | 135 | IPR011006 | CheY-like superfamily |
Gene3D | G3DSA:3.40.50.2300 | 2.5E-42 | 3 | 138 | No hit | No description |
SMART | SM00448 | 6.9E-31 | 4 | 116 | IPR001789 | Signal transduction response regulator, receiver domain |
PROSITE profile | PS50110 | 42.124 | 5 | 120 | IPR001789 | Signal transduction response regulator, receiver domain |
Pfam | PF00072 | 1.5E-25 | 6 | 115 | IPR001789 | Signal transduction response regulator, receiver domain |
CDD | cd00156 | 6.03E-27 | 7 | 119 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 7.8E-28 | 184 | 244 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 5.91E-18 | 184 | 243 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 1.5E-24 | 186 | 239 | IPR006447 | Myb domain, plants |
Pfam | PF00249 | 1.3E-5 | 188 | 238 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0000160 | Biological Process | phosphorelay signal transduction system | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 246 aa Download sequence Send to blast |
PTGLKVLVVD DDPCCLTLLE RMLRECKYAV TTCSRATAAL TILRERKESF DVVISDVHMP 60 DMDGFKLLEL IGLEMGIPVI MMSASGETDA VMKGVVYGAC DYLVKPVRIE ELRNIWQHVV 120 RRRTKDSAVR DEAPEEWEDF MRSTPTDSSE EADVDLRLLR KKKRPSCDFG GGGGDESVRS 180 IASNKKARVV WSFDLHQQFV KAINHIGIEK AVPKRILEVM NIQGLTRENV ASHLQKYRLY 240 LKRLSG |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1irz_A | 2e-21 | 183 | 245 | 2 | 64 | ARR10-B |
Search in ModeBase |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 158 | 164 | LRKKKRP |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}. | |||||
UniProt | Transcriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002967848.1 | 0.0 | two-component response regulator ORR21 isoform X2 | ||||
Swissprot | A2XE31 | 1e-95 | ORR21_ORYSI; Two-component response regulator ORR21 | ||||
Swissprot | Q8H7S7 | 9e-96 | ORR21_ORYSJ; Two-component response regulator ORR21 | ||||
TrEMBL | D8R9R2 | 1e-180 | D8R9R2_SELML; Type B response regulator | ||||
STRING | EFJ31195 | 0.0 | (Selaginella moellendorffii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP292 | 17 | 120 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G16110.1 | 1e-92 | response regulator 2 |
Link Out ? help Back to Top | |
---|---|
Phytozome | 65512 |
Entrez Gene | 9632821 |
Publications ? help Back to Top | |||
---|---|---|---|
|