PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 6091 | ||||||||
Common Name | SELMODRAFT_6091, SELMODRAFT_6100 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 113aa MW: 13557.5 Da PI: 11.0839 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 55.1 | 1.8e-17 | 3 | 48 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg W + Ed++l+++v+++G+ +W+ Ia++++ gR++k+c++rw++ 6091 3 RGHWRPGEDDKLKELVALHGPQNWNMIAEKLQ-GRSGKSCRLRWFNQ 48 899*****************************.***********996 PP | |||||||
2 | Myb_DNA-binding | 62.4 | 9e-20 | 55 | 99 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 r+++T+eE+e+l+ a++ +G++ W+ Iar ++ gRt++ +k++w+ + 6091 55 RQPFTEEEEERLLAAHRFHGNK-WAMIARLFP-GRTDNAVKNHWHVV 99 89********************.*********.***********976 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 26.757 | 1 | 53 | IPR017930 | Myb domain |
SMART | SM00717 | 4.5E-13 | 2 | 51 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 1.57E-29 | 2 | 96 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 1.1E-16 | 3 | 48 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.4E-27 | 4 | 56 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.84E-11 | 6 | 47 | No hit | No description |
SMART | SM00717 | 2.0E-15 | 54 | 102 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 22.167 | 54 | 104 | IPR017930 | Myb domain |
Pfam | PF00249 | 6.7E-16 | 55 | 98 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.7E-22 | 57 | 103 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.68E-6 | 66 | 100 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010199 | Biological Process | organ boundary specification between lateral organs and the meristem | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 113 aa Download sequence Send to blast |
CPRGHWRPGE DDKLKELVAL HGPQNWNMIA EKLQGRSGKS CRLRWFNQLD PRINRQPFTE 60 EEEERLLAAH RFHGNKWAMI ARLFPGRTDN AVKNHWHVVM ARKYRERTRT YGR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 3e-32 | 3 | 104 | 7 | 108 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that involved in boundary specification, meristem initiation and maintenance, and organ patterning. Functions in both lateral organ separation and axillary meristem formation. {ECO:0000269|PubMed:19542355}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00222 | DAP | Transfer from AT1G69560 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002984948.2 | 9e-80 | uncharacterized protein LOC9648767 | ||||
Swissprot | Q9SEZ4 | 4e-66 | MY105_ARATH; Transcription factor MYB105 | ||||
TrEMBL | D8S6T2 | 4e-79 | D8S6T2_SELML; Uncharacterized protein (Fragment) | ||||
STRING | EFJ14198 | 6e-80 | (Selaginella moellendorffii) | ||||
STRING | EFJ19990 | 6e-80 | (Selaginella moellendorffii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP5 | 17 | 1784 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G69560.1 | 4e-64 | myb domain protein 105 |
Link Out ? help Back to Top | |
---|---|
Phytozome | 6091 |
Entrez Gene | 9648767 | 9659301 |
Publications ? help Back to Top | |||
---|---|---|---|
|