PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 59991
Common NameSELMODRAFT_49975, SELMODRAFT_59991
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family SBP
Protein Properties Length: 55aa    MW: 6373.22 Da    PI: 8.5129
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
59991genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP96.62.2e-30155256
           -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT-- CS
    SBP  2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefD 56
           CqvegC++dls+ak+yhrrhkvC +hsk+++v v+++eqrfCqqCsrfh lsefD
  59991  1 CQVEGCKTDLSSAKDYHRRHKVCAMHSKSAKVSVNNIEQRFCQQCSRFHVLSEFD 55
           ******************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031106.8E-24155IPR004333Transcription factor, SBP-box
PROSITE profilePS5114123.726155IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.101.7E-29155IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.44E-27155IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 55 aa     Download sequence    Send to blast
CQVEGCKTDL SSAKDYHRRH KVCAMHSKSA KVSVNNIEQR FCQQCSRFHV LSEFD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj0_A1e-22155660squamosa promoter-binding protein-like 12
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' of AP1 promoter. Binds specifically to the 5'-GTAC-3' core sequence. {ECO:0000269|PubMed:10524240, ECO:0000269|PubMed:16095614}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024533070.13e-33squamosa promoter-binding-like protein 17 isoform X1
SwissprotQ9SMX91e-23SPL1_ARATH; Squamosa promoter-binding-like protein 1
TrEMBLD8RMG03e-32D8RMG0_SELML; Uncharacterized protein (Fragment)
STRINGEFJ146724e-33(Selaginella moellendorffii)
STRINGEFJ263344e-33(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9717230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47070.16e-26squamosa promoter binding protein-like 1
Publications ? help Back to Top
  1. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]
  2. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  3. Chao LM, et al.
    Arabidopsis Transcription Factors SPL1 and SPL12 Confer Plant Thermotolerance at Reproductive Stage.
    Mol Plant, 2017. 10(5): p. 735-748
    [PMID:28400323]