PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 59991 | ||||||||
Common Name | SELMODRAFT_49975, SELMODRAFT_59991 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 55aa MW: 6373.22 Da PI: 8.5129 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 96.6 | 2.2e-30 | 1 | 55 | 2 | 56 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT-- CS SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefD 56 CqvegC++dls+ak+yhrrhkvC +hsk+++v v+++eqrfCqqCsrfh lsefD 59991 1 CQVEGCKTDLSSAKDYHRRHKVCAMHSKSAKVSVNNIEQRFCQQCSRFHVLSEFD 55 ******************************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF03110 | 6.8E-24 | 1 | 55 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 23.726 | 1 | 55 | IPR004333 | Transcription factor, SBP-box |
Gene3D | G3DSA:4.10.1100.10 | 1.7E-29 | 1 | 55 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 1.44E-27 | 1 | 55 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 55 aa Download sequence Send to blast |
CQVEGCKTDL SSAKDYHRRH KVCAMHSKSA KVSVNNIEQR FCQQCSRFHV LSEFD |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj0_A | 1e-22 | 1 | 55 | 6 | 60 | squamosa promoter-binding protein-like 12 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' of AP1 promoter. Binds specifically to the 5'-GTAC-3' core sequence. {ECO:0000269|PubMed:10524240, ECO:0000269|PubMed:16095614}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024533070.1 | 3e-33 | squamosa promoter-binding-like protein 17 isoform X1 | ||||
Swissprot | Q9SMX9 | 1e-23 | SPL1_ARATH; Squamosa promoter-binding-like protein 1 | ||||
TrEMBL | D8RMG0 | 3e-32 | D8RMG0_SELML; Uncharacterized protein (Fragment) | ||||
STRING | EFJ14672 | 4e-33 | (Selaginella moellendorffii) | ||||
STRING | EFJ26334 | 4e-33 | (Selaginella moellendorffii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP97 | 17 | 230 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47070.1 | 6e-26 | squamosa promoter binding protein-like 1 |
Link Out ? help Back to Top | |
---|---|
Phytozome | 59991 |
Entrez Gene | 9645023 | 9650585 |
Publications ? help Back to Top | |||
---|---|---|---|
|