PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 59179 | ||||||||
Common Name | SELMODRAFT_59179 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 116aa MW: 13139.2 Da PI: 9.9692 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 141.8 | 2.2e-44 | 4 | 103 | 1 | 100 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100 +CaaCk+lrrkC+++Cv+apyf +++p+kfa vhk+FGasnv+k+l++lp e+r+da++s+vyeA+ar+rdPvyG++g i++lqqq++ql+++l+++++e 59179 4 PCAACKLLRRKCTRECVFAPYFSSSEPQKFAQVHKIFGASNVSKMLQELPVERRRDAVASIVYEANARIRDPVYGCLGAIFTLQQQIAQLRKQLSAAQSE 103 7**********************************************************************************************99986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 25.709 | 3 | 104 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 4.7E-44 | 4 | 101 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 116 aa Download sequence Send to blast |
SSSPCAACKL LRRKCTRECV FAPYFSSSEP QKFAQVHKIF GASNVSKMLQ ELPVERRRDA 60 VASIVYEANA RIRDPVYGCL GAIFTLQQQI AQLRKQLSAA QSEMVLLKFQ HQHREP |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 4e-47 | 1 | 105 | 8 | 112 | LOB family transfactor Ramosa2.1 |
5ly0_B | 4e-47 | 1 | 105 | 8 | 112 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006353054.1 | 1e-54 | PREDICTED: LOB domain-containing protein 4 | ||||
Refseq | XP_016681402.1 | 1e-54 | PREDICTED: LOB domain-containing protein 12-like | ||||
Refseq | XP_020256238.1 | 2e-54 | LOB domain-containing protein 4 | ||||
Swissprot | Q8LBW3 | 1e-51 | LBD12_ARATH; LOB domain-containing protein 12 | ||||
TrEMBL | D8S3L8 | 2e-79 | D8S3L8_SELML; Uncharacterized protein (Fragment) | ||||
STRING | EFJ21127 | 3e-80 | (Selaginella moellendorffii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP60 | 16 | 318 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G30130.1 | 4e-54 | LBD family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | 59179 |
Entrez Gene | 9657783 |
Publications ? help Back to Top | |||
---|---|---|---|
|