PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 59082 | ||||||||
Common Name | SELMODRAFT_59081, SELMODRAFT_59082 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
|
||||||||
Family | SRS | ||||||||
Protein Properties | Length: 118aa MW: 12859.7 Da PI: 8.5913 | ||||||||
Description | SRS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF702 | 102.7 | 6.4e-32 | 1 | 54 | 8 | 61 |
DUF702 8 CqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaass 61 C++CGnqakkdC+++RCRtCCksrgf+C+thv+stWvpaakrrerq ++aaa + 59082 1 CKECGNQAKKDCVYQRCRTCCKSRGFECSTHVRSTWVPAAKRRERQLAEAAAVA 54 *********************************************988887654 PP | |||||||
2 | DUF702 | 68.8 | 1.7e-21 | 65 | 118 | 100 | 152 |
DUF702 100 letsslPeevsseavfrcvrvssvdd.geeelaYqtavsigGhvfkGiLydqGl 152 +++ slP+ev+++avf+cv+v+sv+d ge+e+aYq++v igG +fkG+L+d+G+ 59082 65 TDAGSLPSEVRAQAVFKCVKVTSVEDgGEDEFAYQAVVRIGGRIFKGVLQDHGV 118 56778*********************899***********************96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF05142 | 4.1E-28 | 1 | 54 | IPR007818 | Protein of unknown function DUF702 |
TIGRFAMs | TIGR01623 | 5.6E-27 | 1 | 42 | IPR006510 | Zinc finger, lateral root primordium type 1 |
Pfam | PF05142 | 6.6E-19 | 67 | 118 | IPR007818 | Protein of unknown function DUF702 |
TIGRFAMs | TIGR01624 | 9.4E-24 | 70 | 118 | IPR006511 | Lateral Root Primordium type 1, C-terminal |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010051 | Biological Process | xylem and phloem pattern formation | ||||
GO:0010252 | Biological Process | auxin homeostasis | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0048479 | Biological Process | style development | ||||
GO:0048480 | Biological Process | stigma development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 118 aa Download sequence Send to blast |
CKECGNQAKK DCVYQRCRTC CKSRGFECST HVRSTWVPAA KRRERQLAEA AAVASGQPPL 60 HLFATDAGSL PSEVRAQAVF KCVKVTSVED GGEDEFAYQA VVRIGGRIFK GVLQDHGV |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that binds DNA on 5'-ACTCTAC-3' and promotes auxin homeostasis-regulating gene expression (e.g. YUC genes), as well as genes affecting stamen development, cell expansion and timing of flowering. Synergistically with other SHI-related proteins, regulates gynoecium, stamen and leaf development in a dose-dependent manner, controlling apical-basal patterning. Promotes style and stigma formation, and influences vascular development during gynoecium development. May also have a role in the formation and/or maintenance of the shoot apical meristem (SAM). {ECO:0000269|PubMed:12361963, ECO:0000269|PubMed:16740145, ECO:0000269|PubMed:16740146, ECO:0000269|PubMed:18811619, ECO:0000269|PubMed:20154152, ECO:0000269|PubMed:22318676}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00613 | PBM | Transfer from AT3G51060 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Regulated by ESR1 and ESR2. {ECO:0000269|PubMed:21976484}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006854799.2 | 6e-49 | protein LATERAL ROOT PRIMORDIUM 1 | ||||
Swissprot | Q9SD40 | 1e-42 | SRS1_ARATH; Protein SHI RELATED SEQUENCE 1 | ||||
TrEMBL | D8RLS7 | 5e-81 | D8RLS7_SELML; Uncharacterized protein (Fragment) | ||||
STRING | EFJ26691 | 9e-82 | (Selaginella moellendorffii) | ||||
STRING | EFJ26976 | 9e-82 | (Selaginella moellendorffii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP1313 | 15 | 49 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G51060.1 | 4e-45 | Lateral root primordium (LRP) protein-related |
Link Out ? help Back to Top | |
---|---|
Phytozome | 59082 |
Entrez Gene | 9640702 | 9651579 |
Publications ? help Back to Top | |||
---|---|---|---|
|