PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 58936 | ||||||||
Common Name | SELMODRAFT_48883, SELMODRAFT_58936 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 117aa MW: 12794.8 Da PI: 8.6039 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 140.9 | 4.1e-44 | 7 | 106 | 1 | 100 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100 +CaaCk+lrr+CakdC++ap fp ++p+kfa+vhk+FGasnv k+l++lp +r da++s+vyeA+ r+rdPvyG+vg i++lqqq++ql+a+la+ ++e 58936 7 PCAACKLLRRRCAKDCIFAPFFPPDEPQKFAYVHKVFGASNVNKMLQDLPVYQRADAVNSMVYEANSRIRDPVYGCVGAISALQQQVAQLQAQLAVSQAE 106 7**********************************************************************************************99987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 26.002 | 6 | 107 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 2.9E-44 | 7 | 104 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 117 aa Download sequence Send to blast |
GAGGMSPCAA CKLLRRRCAK DCIFAPFFPP DEPQKFAYVH KVFGASNVNK MLQDLPVYQR 60 ADAVNSMVYE ANSRIRDPVY GCVGAISALQ QQVAQLQAQL AVSQAEIVCM RMQHAST |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 2e-48 | 3 | 108 | 7 | 112 | LOB family transfactor Ramosa2.1 |
5ly0_B | 2e-48 | 3 | 108 | 7 | 112 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002991941.2 | 6e-82 | LOB domain-containing protein 12 | ||||
Swissprot | Q8LBW3 | 4e-65 | LBD12_ARATH; LOB domain-containing protein 12 | ||||
TrEMBL | D8S9N8 | 5e-81 | D8S9N8_SELML; Uncharacterized protein (Fragment) | ||||
STRING | EFJ07052 | 9e-82 | (Selaginella moellendorffii) | ||||
STRING | EFJ18850 | 9e-82 | (Selaginella moellendorffii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP60 | 16 | 318 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G30130.1 | 2e-55 | LBD family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | 58936 |
Entrez Gene | 9644858 | 9647326 |
Publications ? help Back to Top | |||
---|---|---|---|
|