PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 49084 | ||||||||
Common Name | SELMODRAFT_49084 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 110aa MW: 12159 Da PI: 8.3838 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 143.2 | 8.1e-45 | 2 | 100 | 1 | 99 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 +CaaCk+lrr+Ca+dC++apyfp ++p+kfa+vhk+FGasnv+k+l++lp ++r da+ s+vyeA+ar+rdPvyG+vg i++l+qq++ql+++la ++ 49084 2 PCAACKLLRRRCAQDCIFAPYFPPDEPQKFAFVHKVFGASNVSKMLQDLPLHQRGDAVGSMVYEANARVRDPVYGCVGAISALHQQIAQLQTQLAISQA 100 7*********************************************************************************************99886 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 25.954 | 1 | 102 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 1.2E-44 | 2 | 99 | IPR004883 | Lateral organ boundaries, LOB |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009965 | Biological Process | leaf morphogenesis |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 110 aa Download sequence Send to blast |
SPCAACKLLR RRCAQDCIFA PYFPPDEPQK FAFVHKVFGA SNVSKMLQDL PLHQRGDAVG 60 SMVYEANARV RDPVYGCVGA ISALHQQIAQ LQTQLAISQA ENVCLRMQHS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 2e-47 | 1 | 101 | 10 | 110 | LOB family transfactor Ramosa2.1 |
5ly0_B | 2e-47 | 1 | 101 | 10 | 110 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002984853.2 | 5e-78 | LOB domain-containing protein 4 | ||||
Swissprot | Q8LBW3 | 6e-61 | LBD12_ARATH; LOB domain-containing protein 12 | ||||
TrEMBL | D8SN28 | 9e-76 | D8SN28_SELML; Uncharacterized protein (Fragment) | ||||
STRING | EFJ14103 | 2e-76 | (Selaginella moellendorffii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP60 | 16 | 318 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G30130.1 | 5e-53 | LBD family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | 49084 |
Entrez Gene | 9645000 |
Publications ? help Back to Top | |||
---|---|---|---|
|