PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 47768 | ||||||||
Common Name | SELMODRAFT_47768 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 181aa MW: 20116.8 Da PI: 8.4864 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 28.4 | 3.9e-09 | 6 | 58 | 3 | 46 |
SS-HHHHHHHHHHHHHTTTT..........-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGgg..........tWktIartmgkgRtlkqcksrwqk 46 +W+ e d+l+ +a + + + +W+++a+ ++ g+t+ +++ ++ 47768 6 KWSSEQDKLFEKALAGWEDKcddpegvagsRWEAVAALVP-GKTAADVRAHYEL 58 7*****************99********************.**********975 PP | |||||||
2 | Myb_DNA-binding | 42.5 | 1.5e-13 | 114 | 158 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +WT++E+ l++ + +++G+g+W++I+r + Rt+ q+ s+ qky 47768 114 PWTEDEHRLFLLGLEKFGKGDWRSISRNFVVSRTPTQVASHAQKY 158 7*******************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50090 | 6.191 | 1 | 60 | IPR017877 | Myb-like domain |
SMART | SM00717 | 2.8E-5 | 3 | 62 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 2.66E-7 | 6 | 67 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 1.4E-4 | 6 | 61 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.34E-5 | 6 | 60 | No hit | No description |
Pfam | PF00249 | 2.6E-7 | 6 | 57 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 16.947 | 106 | 163 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 4.88E-17 | 109 | 164 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.1E-10 | 111 | 161 | IPR001005 | SANT/Myb domain |
TIGRFAMs | TIGR01557 | 4.1E-18 | 111 | 161 | IPR006447 | Myb domain, plants |
Gene3D | G3DSA:1.10.10.60 | 2.9E-11 | 112 | 157 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 6.49E-10 | 114 | 159 | No hit | No description |
Pfam | PF00249 | 2.9E-11 | 114 | 158 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 181 aa Download sequence Send to blast |
SPSAAKWSSE QDKLFEKALA GWEDKCDDPE GVAGSRWEAV AALVPGKTAA DVRAHYELLL 60 RDISSIEAGL IALPCYSPRD ALLVKDSSLA LDKKLGLPSS SCSSPDQERR KGIPWTEDEH 120 RLFLLGLEKF GKGDWRSISR NFVVSRTPTQ VASHAQKYFI RLNSIHKDKR RTSIHDITSV 180 N |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that coordinates abscisic acid (ABA) biosynthesis and signaling-related genes via binding to the specific promoter motif 5'-(A/T)AACCAT-3'. Represses ABA-mediated salt (e.g. NaCl and KCl) stress tolerance. Regulates leaf shape and promotes vegetative growth. {ECO:0000269|PubMed:26243618}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00500 | DAP | Transfer from AT5G08520 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by salicylic acid (SA) and gibberellic acid (GA) (PubMed:16463103). Triggered by dehydration and salt stress (PubMed:26243618). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:26243618}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024519292.1 | 1e-119 | transcription factor SRM1 | ||||
Swissprot | Q9FNN6 | 1e-64 | SRM1_ARATH; Transcription factor SRM1 | ||||
TrEMBL | D8T267 | 1e-129 | D8T267_SELML; Uncharacterized protein (Fragment) | ||||
STRING | EFJ09209 | 1e-130 | (Selaginella moellendorffii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP275 | 17 | 122 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G08520.1 | 9e-56 | MYB family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | 47768 |
Entrez Gene | 9638106 |
Publications ? help Back to Top | |||
---|---|---|---|
|