PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 47303 | ||||||||
Common Name | SELMODRAFT_47302, SELMODRAFT_47303 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
|
||||||||
Family | G2-like | ||||||||
Protein Properties | Length: 72aa MW: 8197.52 Da PI: 11.6211 | ||||||||
Description | G2-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | G2-like | 104.3 | 7e-33 | 7 | 60 | 2 | 55 |
G2-like 2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 r+rWt++LH++Fv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+ 47303 7 RRMRWTSTLHAHFVHAVELLGGHERATPKSVLELMNVKDLTLAHVKSHLQMYRT 60 69***************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF46689 | 4.03E-17 | 4 | 61 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 3.1E-29 | 5 | 60 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 3.4E-25 | 7 | 61 | IPR006447 | Myb domain, plants |
Pfam | PF00249 | 2.1E-8 | 8 | 59 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010158 | Biological Process | abaxial cell fate specification | ||||
GO:0010229 | Biological Process | inflorescence development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 72 aa Download sequence Send to blast |
KRSMRARRMR WTSTLHAHFV HAVELLGGHE RATPKSVLEL MNVKDLTLAH VKSHLQMYRT 60 IKTTDKASSS SG |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6j4k_A | 1e-19 | 8 | 62 | 4 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j4k_B | 1e-19 | 8 | 62 | 4 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j5b_A | 1e-19 | 8 | 62 | 4 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j5b_C | 1e-19 | 8 | 62 | 4 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j5b_D | 1e-19 | 8 | 62 | 4 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j5b_F | 1e-19 | 8 | 62 | 4 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j5b_H | 1e-19 | 8 | 62 | 4 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j5b_J | 1e-19 | 8 | 62 | 4 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that regulates lateral organ polarity. Promotes abaxial cell fate during lateral organd formation. Functions with KAN1 in the specification of polarity of the ovule outer integument. {ECO:0000269|PubMed:11525739, ECO:0000269|PubMed:15286295, ECO:0000269|PubMed:16623911, ECO:0000269|PubMed:17307928}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002983716.2 | 3e-43 | uncharacterized protein LOC9644200 | ||||
Refseq | XP_002989046.2 | 3e-43 | uncharacterized protein LOC9629510 | ||||
Swissprot | Q9C616 | 1e-39 | KAN2_ARATH; Probable transcription factor KAN2 | ||||
TrEMBL | D8SKE4 | 1e-44 | D8SKE4_SELML; Uncharacterized protein (Fragment) | ||||
STRING | EFJ09840 | 2e-45 | (Selaginella moellendorffii) | ||||
STRING | EFJ15212 | 2e-45 | (Selaginella moellendorffii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP570 | 15 | 80 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G42630.2 | 6e-43 | G2-like family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | 47303 |
Entrez Gene | 9629510 | 9644200 |
Publications ? help Back to Top | |||
---|---|---|---|
|