PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 4561
Common NameSELMODRAFT_404178, SELMODRAFT_407157, WOX8-1, WOX8-2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family WOX
Protein Properties Length: 168aa    MW: 19385.6 Da    PI: 10.2522
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
4561genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox665.1e-2168128257
               T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
  Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
               r+R+t++++ql++Le+lF++ n +p++++++e++++l    +++e++V++WFqNr+a+ k+
      4561  68 RQRWTPSQNQLRILERLFKQgNGTPNRQRIKEITSELsqhgQISETNVYNWFQNRKARAKR 128
               89*****************99**************************************97 PP

2Wus_type_Homeobox98.64.9e-3267130265
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        +r+RWtP+++Q++iLe+l+k+G  tPn+++i++it+eL+++G+i+++NV++WFQNrkaR ++kq
               4561  67 SRQRWTPSQNQLRILERLFKQGNGTPNRQRIKEITSELSQHGQISETNVYNWFQNRKARAKRKQ 130
                        789***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.61E-1763133IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-1563133IPR009057Homeodomain-like
PROSITE profilePS5007115.12764129IPR001356Homeobox domain
SMARTSM003892.6E-1266133IPR001356Homeobox domain
PfamPF000461.3E-1868128IPR001356Homeobox domain
CDDcd000862.17E-1068130No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 168 aa     Download sequence    Send to blast
QVMTEEQLET LRRQISVYAT ICQQLVEMHK ATISHQHTYN GLLLGHQSPA IQDSSPMLLG  60
IHHKPTSRQR WTPSQNQLRI LERLFKQGNG TPNRQRIKEI TSELSQHGQI SETNVYNWFQ  120
NRKARAKRKQ RHNNATPSTT TTSSQHKDAE SEVETDGDHS PEEKRSKV
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1124130RAKRKQR
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00669PBMTransfer from GRMZM2G038252Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002962413.11e-120WUSCHEL-related homeobox 13
RefseqXP_002965624.11e-120WUSCHEL-related homeobox 13
SwissprotQ5QMM33e-53WOX8_ORYSJ; WUSCHEL-related homeobox 8
TrEMBLD8QUI11e-119D8QUI1_SELML; Uncharacterized protein WOX8-1
STRINGEFJ330441e-120(Selaginella moellendorffii)
STRINGEFJ358761e-120(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP18731639
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35550.19e-44WUSCHEL related homeobox 13
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]