PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 417553
Common NameSELMODRAFT_417553, WOX5-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family WOX
Protein Properties Length: 269aa    MW: 29087.2 Da    PI: 6.1786
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
417553genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox48.71.3e-1564122357
               --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
  Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
               +R++++++ql +Lee+++k   ps+e  +e+A+ +     ++e++V++WFqN++ +ek+
    417553  64 QRWRPNSQQLGILEEFYAKGTPPSQENVTEIAELIghhgPVDESKVYYWFQNKKSREKR 122
               8**********************************99999******************7 PP

2Wus_type_Homeobox69.84.6e-2362124265
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        a++RW P+++Q+ iLee y +G+  P++e++++i++ + ++G +++  V+yWFQN+k+Re++k+
             417553  62 AQQRWRPNSQQLGILEEFYAKGT-PPSQENVTEIAELIGHHGPVDESKVYYWFQNKKSREKRKR 124
                        689*******************7.699***********************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.99E-1456126IPR009057Homeodomain-like
PROSITE profilePS5007112.50359123IPR001356Homeobox domain
SMARTSM003891.9E-661127IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.609.2E-1262126IPR009057Homeodomain-like
PfamPF000461.6E-1364122IPR001356Homeobox domain
CDDcd000865.81E-665115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MRRCEQQAAS SPASSESDQI DQERDINTEL LELKALHMHH RSRRKHIEIS SVPAPPAPTR  60
PAQQRWRPNS QQLGILEEFY AKGTPPSQEN VTEIAELIGH HGPVDESKVY YWFQNKKSRE  120
KRKRRRIEEA NAASGASASS SPAAASATAA FQQDLSSSAP SASASASSGS EQLHHPAAQS  180
YAAAQIVIDG GVVSIIDDKS PFDLVGHFGD GAALFDPALG RIVPTNERGV TLEPLESRAY  240
TLVWPIPLAH EASQLGSFAN LEDPPWSL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1120125KRKRRR
2121125RKRRR
3122126KRRRI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024538362.11e-117WUSCHEL-related homeobox 11
TrEMBLD8S2U50.0D8S2U5_SELML; Uncharacterized protein WOX5-1
STRINGEFJ209920.0(Selaginella moellendorffii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20700.11e-06WUSCHEL related homeobox 14
Publications ? help Back to Top
  1. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]