PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 39729
Common NameSELMODRAFT_451355, WOX7-2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family WOX
Protein Properties Length: 64aa    MW: 7554.54 Da    PI: 11.7465
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
39729genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox53.34.5e-17363257
              T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
  Homeobox  2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
              r+R+++++ q++ Le+l+     +p +++ +e++++l     ++e++V++WFqNr+a+ ++
     39729  3 RQRWAPSQAQVKLLESLYDVgMGTPHKQRVREITAELsqlgPVNESNVYNWFQNRKARTRR 63
              89*****************88*****************9999****************997 PP

2Wus_type_Homeobox93.51.8e-30264264
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64
                       +r+RW+P++ Q+k+Le+ly+ G+ tP k+++++itaeL++ G +++ NV++WFQNrkaR r++
              39729  2 TRQRWAPSQAQVKLLESLYDVGMGTPHKQRVREITAELSQLGPVNESNVYNWFQNRKARTRRR 64
                       789**********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003899.2E-4164IPR001356Homeobox domain
PROSITE profilePS5007112.519164IPR001356Homeobox domain
SuperFamilySSF466896.84E-14264IPR009057Homeodomain-like
PfamPF000461.0E-14363IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.608.1E-11364IPR009057Homeodomain-like
CDDcd000861.21E-4364No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 64 aa     Download sequence    Send to blast
TTRQRWAPSQ AQVKLLESLY DVGMGTPHKQ RVREITAELS QLGPVNESNV YNWFQNRKAR  60
TRRR
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024524489.15e-40WUSCHEL-related homeobox 8
SwissprotQ5QMM33e-23WOX8_ORYSJ; WUSCHEL-related homeobox 8
TrEMBLD8RWE87e-39D8RWE8_SELML; Uncharacterized protein WOX7-2
STRINGEFJ236571e-39(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP18731639
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20700.12e-25WUSCHEL related homeobox 14
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]