PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 39481 | ||||||||
Common Name | MYB4C-1, MYB4C-2, SELMODRAFT_39454, SELMODRAFT_39481 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 87aa MW: 10016.5 Da PI: 8.6647 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 59 | 1.1e-18 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT eEd ll ++v+++G g+W+t ++ g++R++k+c++rw +yl 39481 14 RGPWTREEDTLLTQYVNEHGEGSWRTLPKAAGLRRCGKSCRLRWINYL 61 89********************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 1.8E-24 | 5 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 23.482 | 9 | 65 | IPR017930 | Myb domain |
SMART | SM00717 | 1.1E-13 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 9.7E-17 | 14 | 61 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 2.04E-23 | 15 | 87 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.70E-10 | 16 | 61 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 5.2E-8 | 65 | 87 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 8.67 | 66 | 87 | IPR017930 | Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 87 aa Download sequence Send to blast |
MGRSPCCEKI GLNRGPWTRE EDTLLTQYVN EHGEGSWRTL PKAAGLRRCG KSCRLRWINY 60 LRPNLKHGNI TEEEDELIVK LHSLLGN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 1e-15 | 12 | 87 | 25 | 99 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By nitrogen, salicylic acid, NaCl and abscisic acid (ABA). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:18541146, ECO:0000269|PubMed:9839469}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002988111.2 | 2e-58 | myb-related protein 308 | ||||
Swissprot | Q9S9K9 | 7e-45 | MYB3_ARATH; Transcription factor MYB3 | ||||
TrEMBL | D8RNP8 | 6e-57 | D8RNP8_SELML; Uncharacterized protein MYB4C-1 (Fragment) | ||||
STRING | EFJ10903 | 1e-57 | (Selaginella moellendorffii) | ||||
STRING | EFJ25905 | 1e-57 | (Selaginella moellendorffii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP5 | 17 | 1784 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G22640.1 | 3e-47 | myb domain protein 3 |
Link Out ? help Back to Top | |
---|---|
Phytozome | 39481 |
Entrez Gene | 9637007 | 9657501 |