PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 38644 | ||||||||
Common Name | SELMODRAFT_38644 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 101aa MW: 11945.6 Da PI: 11.2344 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 54.5 | 2.7e-17 | 1 | 46 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg W + Ed++l+++v+++G+ +W+ Ia+ + gR++k+c++rw++ 38644 1 RGHWRPAEDDKLKQLVALHGPQNWNVIAENLH-GRSGKSCRLRWFNQ 46 899*****************************.***********996 PP | |||||||
2 | Myb_DNA-binding | 59.5 | 7.4e-19 | 53 | 96 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 r ++++eE+++l a++ +G++ W++Iar ++ gRt++ +k++w+ 38644 53 RRPFSEEEEDRLMAAHQIHGNK-WALIARLFP-GRTDNAVKNHWHV 96 679*******************.*********.***********96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF46689 | 1.39E-29 | 1 | 94 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 19.577 | 1 | 47 | IPR017930 | Myb domain |
Pfam | PF00249 | 3.6E-17 | 1 | 47 | IPR001005 | SANT/Myb domain |
SMART | SM00717 | 1.6E-11 | 1 | 49 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.6E-26 | 2 | 54 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 9.74E-12 | 4 | 45 | No hit | No description |
PROSITE profile | PS51294 | 26.983 | 48 | 101 | IPR017930 | Myb domain |
SMART | SM00717 | 1.3E-14 | 52 | 100 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.9E-16 | 53 | 95 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.60E-10 | 55 | 95 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 2.3E-22 | 55 | 101 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 101 aa Download sequence Send to blast |
RGHWRPAEDD KLKQLVALHG PQNWNVIAEN LHGRSGKSCR LRWFNQLDPR INRRPFSEEE 60 EDRLMAAHQI HGNKWALIAR LFPGRTDNAV KNHWHVIMAR K |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1gv2_A | 2e-31 | 1 | 101 | 4 | 104 | MYB PROTO-ONCOGENE PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that involved in boundary specification, meristem initiation and maintenance, and organ patterning. Functions in both lateral organ separation and axillary meristem formation. {ECO:0000269|PubMed:19542355}. | |||||
UniProt | Transcription factor required for sugar partitioning from leaves to anthers during male reproductive development. Required for the production of functional pollen grains. Binds to the promoter of the anther-specific sugar transporter MST8 and regulates its expression. Regulates the expression of genes involved in sugar partitioning in flower, such as the sugar transporter SUT3, the invertase INV4, the UDP-glucose pyrophosphorylase UGP2 and the starch synthase WAXY. {ECO:0000269|PubMed:20305120}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by wounding. {ECO:0000269|PubMed:20305120}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC158180 | 1e-108 | Selaginella moellendorffii chromosome JGIASXY-5A14, complete sequence |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002973845.2 | 1e-69 | myb protein isoform X2 | ||||
Refseq | XP_002983547.2 | 2e-69 | transcription factor MYB88, partial | ||||
Refseq | XP_024534435.1 | 1e-69 | myb protein isoform X1 | ||||
Swissprot | Q5NBM8 | 7e-60 | CSA_ORYSJ; Transcription factor CSA | ||||
Swissprot | Q9SEZ4 | 6e-60 | MY105_ARATH; Transcription factor MYB105 | ||||
TrEMBL | D8RS30 | 2e-68 | D8RS30_SELML; Uncharacterized protein (Fragment) | ||||
TrEMBL | D8SJG6 | 2e-68 | D8SJG6_SELML; Uncharacterized protein (Fragment) | ||||
STRING | EFJ15448 | 3e-69 | (Selaginella moellendorffii) | ||||
STRING | EFJ24800 | 3e-69 | (Selaginella moellendorffii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP5 | 17 | 1784 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G69560.1 | 2e-62 | myb domain protein 105 |
Link Out ? help Back to Top | |
---|---|
Phytozome | 38644 |
Entrez Gene | 9643040 |