PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 38644
Common NameSELMODRAFT_38644
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family MYB
Protein Properties Length: 101aa    MW: 11945.6 Da    PI: 11.2344
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
38644genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.52.7e-17146147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg W + Ed++l+++v+++G+ +W+ Ia+ +  gR++k+c++rw++ 
            38644  1 RGHWRPAEDDKLKQLVALHGPQNWNVIAENLH-GRSGKSCRLRWFNQ 46
                     899*****************************.***********996 PP

2Myb_DNA-binding59.57.4e-195396146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     r ++++eE+++l  a++ +G++ W++Iar ++ gRt++ +k++w+ 
            38644 53 RRPFSEEEEDRLMAAHQIHGNK-WALIARLFP-GRTDNAVKNHWHV 96
                     679*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.39E-29194IPR009057Homeodomain-like
PROSITE profilePS5129419.577147IPR017930Myb domain
PfamPF002493.6E-17147IPR001005SANT/Myb domain
SMARTSM007171.6E-11149IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-26254IPR009057Homeodomain-like
CDDcd001679.74E-12445No hitNo description
PROSITE profilePS5129426.98348101IPR017930Myb domain
SMARTSM007171.3E-1452100IPR001005SANT/Myb domain
PfamPF002494.9E-165395IPR001005SANT/Myb domain
CDDcd001672.60E-105595No hitNo description
Gene3DG3DSA:1.10.10.602.3E-2255101IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 101 aa     Download sequence    Send to blast
RGHWRPAEDD KLKQLVALHG PQNWNVIAEN LHGRSGKSCR LRWFNQLDPR INRRPFSEEE  60
EDRLMAAHQI HGNKWALIAR LFPGRTDNAV KNHWHVIMAR K
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-3111014104MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that involved in boundary specification, meristem initiation and maintenance, and organ patterning. Functions in both lateral organ separation and axillary meristem formation. {ECO:0000269|PubMed:19542355}.
UniProtTranscription factor required for sugar partitioning from leaves to anthers during male reproductive development. Required for the production of functional pollen grains. Binds to the promoter of the anther-specific sugar transporter MST8 and regulates its expression. Regulates the expression of genes involved in sugar partitioning in flower, such as the sugar transporter SUT3, the invertase INV4, the UDP-glucose pyrophosphorylase UGP2 and the starch synthase WAXY. {ECO:0000269|PubMed:20305120}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by wounding. {ECO:0000269|PubMed:20305120}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1581801e-108Selaginella moellendorffii chromosome JGIASXY-5A14, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002973845.21e-69myb protein isoform X2
RefseqXP_002983547.22e-69transcription factor MYB88, partial
RefseqXP_024534435.11e-69myb protein isoform X1
SwissprotQ5NBM87e-60CSA_ORYSJ; Transcription factor CSA
SwissprotQ9SEZ46e-60MY105_ARATH; Transcription factor MYB105
TrEMBLD8RS302e-68D8RS30_SELML; Uncharacterized protein (Fragment)
TrEMBLD8SJG62e-68D8SJG6_SELML; Uncharacterized protein (Fragment)
STRINGEFJ154483e-69(Selaginella moellendorffii)
STRINGEFJ248003e-69(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.12e-62myb domain protein 105
Publications ? help Back to Top
  1. Leonard LM,Follette VM
    Sexual functioning in women reporting a history of child sexual abuse: review of the empirical literature and clinical implications.
    Annu Rev Sex Res, 2002. 13: p. 346-88
    [PMID:12836736]
  2. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  3. Wang L,Li X,Chen Z
    Sulfated modification of the polysaccharides obtained from defatted rice bran and their antitumor activities.
    Int. J. Biol. Macromol., 2009. 44(2): p. 211-4
    [PMID:19135473]
  4. Wang L,Huang H,Wei Y,Li X,Chen Z
    Characterization and anti-tumor activities of sulfated polysaccharide SRBPS2a obtained from defatted rice bran.
    Int. J. Biol. Macromol., 2009. 45(4): p. 427-31
    [PMID:19549538]
  5. Zhang H, et al.
    Carbon starved anther encodes a MYB domain protein that regulates sugar partitioning required for rice pollen development.
    Plant Cell, 2010. 22(3): p. 672-89
    [PMID:20305120]
  6. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]
  7. Zhang H, et al.
    Mutation in CSA creates a new photoperiod-sensitive genic male sterile line applicable for hybrid rice seed production.
    Proc. Natl. Acad. Sci. U.S.A., 2013. 110(1): p. 76-81
    [PMID:23256151]
  8. Zhu X, et al.
    Brassinosteroids promote development of rice pollen grains and seeds by triggering expression of Carbon Starved Anther, a MYB domain protein.
    Plant J., 2015. 82(4): p. 570-81
    [PMID:25754973]
  9. Li X, et al.
    Metabolic and transcriptomic signatures of rice floral organs reveal sugar starvation as a factor in reproductive failure under heat and drought stress.
    Plant Cell Environ., 2015. 38(10): p. 2171-92
    [PMID:25828772]
  10. Shaar-Moshe L,Hübner S,Peleg Z
    Identification of conserved drought-adaptive genes using a cross-species meta-analysis approach.
    BMC Plant Biol., 2015. 15: p. 111
    [PMID:25935420]