PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 29850 | ||||||||
Common Name | SELMODRAFT_29850, SELMODRAFT_9604 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 58aa MW: 7065.02 Da PI: 10.1161 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 54.2 | 3.4e-17 | 17 | 58 | 1 | 44 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 r+ W ++E++llv a+++lG++ W+ Ia+ ++ gRt++ +k++w 29850 17 RDIWREDEEQLLVSAHNRLGNK-WADIAKLIP-GRTENAIKNHW 58 567*******************.*********.*********** PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF46689 | 4.6E-21 | 1 | 58 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 2.6E-9 | 1 | 24 | IPR009057 | Homeodomain-like |
PROSITE profile | PS50090 | 4.182 | 1 | 11 | IPR017877 | Myb-like domain |
PROSITE profile | PS51294 | 22.001 | 12 | 58 | IPR017930 | Myb domain |
SMART | SM00717 | 1.6E-6 | 16 | 58 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.0E-15 | 20 | 58 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.96E-8 | 20 | 58 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 2.5E-16 | 25 | 58 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 58 aa Download sequence Send to blast |
KQCRERWHNH LKPDIKRDIW REDEEQLLVS AHNRLGNKWA DIAKLIPGRT ENAIKNHW |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1gv2_A | 1e-25 | 1 | 58 | 40 | 97 | MYB PROTO-ONCOGENE PROTEIN |
1mse_C | 1e-25 | 1 | 58 | 40 | 97 | C-Myb DNA-Binding Domain |
1msf_C | 1e-25 | 1 | 58 | 40 | 97 | C-Myb DNA-Binding Domain |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor required for female gametophyte fertility. Acts redundantly with MYB64 to initiate the FG5 transition during female gametophyte development. The FG5 transition represents the switch between free nuclear divisions and cellularization-differentiation in female gametophyte, and occurs during developmental stage FG5. {ECO:0000269|PubMed:24068955}. | |||||
UniProt | Transcription factor required for female gametophyte fertility (PubMed:23057675, PubMed:24068955). Acts redundantly with MYB119 to initiate the FG5 transition during female gametophyte development. The FG5 transition represents the switch between free nuclear divisions and cellularization-differentiation in female gametophyte, and occurs during developmental stage FG5 (PubMed:24068955). {ECO:0000269|PubMed:23057675, ECO:0000269|PubMed:24068955}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002992026.2 | 5e-34 | myb-related protein B | ||||
Swissprot | Q9FIM4 | 2e-27 | MY119_ARATH; Transcription factor MYB119 | ||||
Swissprot | Q9FY60 | 1e-27 | MYB64_ARATH; Transcription factor MYB64 | ||||
TrEMBL | D8QZP1 | 3e-34 | D8QZP1_SELML; Uncharacterized protein (Fragment) | ||||
STRING | EFJ06875 | 5e-35 | (Selaginella moellendorffii) | ||||
STRING | EFJ34835 | 5e-35 | (Selaginella moellendorffii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP5 | 17 | 1784 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G11050.1 | 5e-30 | myb domain protein 64 |
Link Out ? help Back to Top | |
---|---|
Phytozome | 29850 |
Entrez Gene | 9650219 | 9655696 |
Publications ? help Back to Top | |||
---|---|---|---|
|