PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 29437 | ||||||||
Common Name | SELMODRAFT_86653 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 99aa MW: 11605.5 Da PI: 10.5791 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 51.2 | 2.8e-16 | 2 | 51 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHT.TTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGgg.tWktIartmg.kgRtlkqcksrwqkyl 48 rg+WT eEd ll++ k++G + +W+++++ g + R++k+c++rw++yl 29437 2 RGPWTLEEDALLLRHMKLYGDRgNWRKVPKAAGcLLRCGKSCRLRWLNYL 51 89***********************************************7 PP | |||||||
2 | Myb_DNA-binding | 49.2 | 1.2e-15 | 57 | 99 | 1 | 45 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 rg+++++Ed l+++++ +lG++ W+ Ia +++ gR+++++k++w+ 29437 57 RGSFSEDEDALIIKLHSLLGNR-WSIIAGRIP-GRSDNEIKNYWN 99 89********************.*********.***********7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00717 | 1.9E-12 | 1 | 53 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 16.285 | 1 | 51 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 8.61E-27 | 2 | 98 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 4.4E-15 | 2 | 51 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.1E-22 | 3 | 58 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.03E-8 | 4 | 51 | No hit | No description |
PROSITE profile | PS51294 | 24.176 | 52 | 99 | IPR017930 | Myb domain |
SMART | SM00717 | 2.2E-8 | 56 | 99 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.4E-14 | 57 | 99 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.40E-9 | 59 | 99 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.1E-22 | 59 | 99 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 99 aa Download sequence Send to blast |
RRGPWTLEED ALLLRHMKLY GDRGNWRKVP KAAGCLLRCG KSCRLRWLNY LRPDLKRGSF 60 SEDEDALIIK LHSLLGNRWS IIAGRIPGRS DNEIKNYWN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 3e-26 | 2 | 99 | 27 | 121 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription repressor involved in regulation of protection against UV. Mediates transcriptional repression of CYP73A5, the gene encoding trans-cinnamate 4-monooxygenase, thereby regulating the accumulation of the UV-protectant compound sinapoylmalate. {ECO:0000269|PubMed:11080161}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Down-regulated by exposure to UV-B light. {ECO:0000269|PubMed:11080161}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024527557.1 | 1e-63 | transcription repressor MYB5 | ||||
Swissprot | Q9SZP1 | 9e-46 | MYB4_ARATH; Transcription repressor MYB4 | ||||
TrEMBL | D8QQ83 | 6e-65 | D8QQ83_SELML; Uncharacterized protein (Fragment) | ||||
TrEMBL | D8R8P7 | 9e-65 | D8R8P7_SELML; Uncharacterized protein (Fragment) | ||||
STRING | EFJ32101 | 2e-65 | (Selaginella moellendorffii) | ||||
STRING | EFJ37745 | 1e-65 | (Selaginella moellendorffii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP5 | 17 | 1784 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G38620.1 | 4e-48 | myb domain protein 4 |
Link Out ? help Back to Top | |
---|---|
Phytozome | 29437 |
Entrez Gene | 9636070 |