PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 28626 | ||||||||
Common Name | SELMODRAFT_28625, SELMODRAFT_28626 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 83aa MW: 9450.74 Da PI: 11.0362 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 131.4 | 3.1e-41 | 9 | 83 | 1 | 75 |
--SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S CS SBP 1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrk 75 +Cqv+gC adls k yhrrh+vCe hskap+ +v+g+eqrfCqqCsrfh l fDe+krsCrrrLa+hn+rrrk 28626 9 RCQVDGCGADLSGSKGYHRRHRVCELHSKAPKSIVKGQEQRFCQQCSRFHGLGYFDEGKRSCRRRLAGHNQRRRK 83 6*************************************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:4.10.1100.10 | 4.3E-36 | 3 | 71 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 32.394 | 7 | 83 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 1.22E-37 | 8 | 83 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 4.3E-33 | 10 | 83 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 83 aa Download sequence Send to blast |
VAQPAATPRC QVDGCGADLS GSKGYHRRHR VCELHSKAPK SIVKGQEQRF CQQCSRFHGL 60 GYFDEGKRSC RRRLAGHNQR RRK |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ul4_A | 1e-31 | 10 | 83 | 11 | 84 | squamosa promoter binding protein-like 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May play a role in plant development. {ECO:0000250, ECO:0000269|PubMed:15703061}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002962307.2 | 1e-54 | squamosa promoter-binding-like protein 14 | ||||
Refseq | XP_002965226.2 | 2e-53 | uncharacterized protein LOC9660230 | ||||
Swissprot | Q8RY95 | 9e-35 | SPL14_ARATH; Squamosa promoter-binding-like protein 14 | ||||
TrEMBL | D8QT82 | 4e-53 | D8QT82_SELML; Uncharacterized protein (Fragment) | ||||
STRING | EFJ34064 | 6e-54 | (Selaginella moellendorffii) | ||||
STRING | EFJ37567 | 6e-54 | (Selaginella moellendorffii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP97 | 17 | 230 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G20980.1 | 4e-37 | squamosa promoter binding protein-like 14 |
Link Out ? help Back to Top | |
---|---|
Phytozome | 28626 |
Entrez Gene | 9647112 | 9660230 |
Publications ? help Back to Top | |||
---|---|---|---|
|