PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 28626
Common NameSELMODRAFT_28625, SELMODRAFT_28626
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family SBP
Protein Properties Length: 83aa    MW: 9450.74 Da    PI: 11.0362
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
28626genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP131.43.1e-41983175
           --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S CS
    SBP  1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrk 75
           +Cqv+gC adls  k yhrrh+vCe hskap+ +v+g+eqrfCqqCsrfh l  fDe+krsCrrrLa+hn+rrrk
  28626  9 RCQVDGCGADLSGSKGYHRRHRVCELHSKAPKSIVKGQEQRFCQQCSRFHGLGYFDEGKRSCRRRLAGHNQRRRK 83
           6*************************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.3E-36371IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.394783IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.22E-37883IPR004333Transcription factor, SBP-box
PfamPF031104.3E-331083IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 83 aa     Download sequence    Send to blast
VAQPAATPRC QVDGCGADLS GSKGYHRRHR VCELHSKAPK SIVKGQEQRF CQQCSRFHGL  60
GYFDEGKRSC RRRLAGHNQR RRK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-3110831184squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May play a role in plant development. {ECO:0000250, ECO:0000269|PubMed:15703061}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002962307.21e-54squamosa promoter-binding-like protein 14
RefseqXP_002965226.22e-53uncharacterized protein LOC9660230
SwissprotQ8RY959e-35SPL14_ARATH; Squamosa promoter-binding-like protein 14
TrEMBLD8QT824e-53D8QT82_SELML; Uncharacterized protein (Fragment)
STRINGEFJ340646e-54(Selaginella moellendorffii)
STRINGEFJ375676e-54(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9717230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20980.14e-37squamosa promoter binding protein-like 14
Publications ? help Back to Top
  1. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]
  2. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  3. Liu J, et al.
    Characterizing Variation of Branch Angle and Genome-Wide Association Mapping in Rapeseed (Brassica napus L.).
    Front Plant Sci, 2016. 7: p. 21
    [PMID:26870051]