PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

19633

Common Name

SELMODRAFT_19633

Organism

Selaginella moellendorffii

Taxonomic ID

88036

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella

Family

Dof

Protein Properties

Length: 59aa MW: 7034.96 Da PI: 9.972

Description

Dof family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
19633	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	zf-Dof	66.2	5.5e-21	12	59	3	50
zf-Dof 3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvP 50 e+ + cprC s +tkfCy nn sqPry C +C+r +tkGG +r vP 19633 12 EEPTICPRCSSIDTKFCYNNNKKASQPRYRCNSCKRKFTKGGRIRFVP 59 67889****************************************999 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD007478	2.0E-10	10	59	IPR003851	Zinc finger, Dof-type
Pfam	PF02701	2.5E-21	14	59	IPR003851	Zinc finger, Dof-type
PROSITE profile	PS50884	19.489	15	59	IPR003851	Zinc finger, Dof-type

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 59 aa Download sequence Send to blast
QEYNSQHKFQ DEEPTICPRC SSIDTKFCYN NNKKASQPRY RCNSCKRKFT KGGRIRFVP

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Promotes expression (PubMed:19915089). The PEAR proteins (e.g. DOF2.4, DOF5.1, DOF3.2, DOF1.1, DOF5.6 and DOF5.3) activate gene expression that promotes radial growth of protophloem sieve elements (PubMed:30626969). Involved in the regulation of interfascicular cambium formation and vascular tissue development, particularly at a very early stage during inflorescence stem development; promotes both cambium activity and phloem specification, but prevents xylem specification (PubMed:19915089). {ECO:0000250\|UniProtKB:Q9M2U1, ECO:0000269\|PubMed:19915089, ECO:0000269\|PubMed:30626969}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004953626.1	1e-14	dof zinc finger protein 1
Refseq	XP_016745239.1	8e-15	PREDICTED: dof zinc finger protein DOF2.1-like
Swissprot	Q9FM03	2e-13	DOF56_ARATH; Dof zinc finger protein DOF5.6
TrEMBL	D8SIS9	1e-35	D8SIS9_SELML; Uncharacterized protein (Fragment)
STRING	EFJ15677	2e-36	(Selaginella moellendorffii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP38	17	445

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G62940.1	9e-16	Dof family protein

Link Out ? help Back to Top
Phytozome	19633
Entrez Gene	9654468

Publications ? help Back to Top
Banks JA, et al. The Selaginella genome identifies genetic changes associated with the evolution of vascular plants. Science, 2011. 332(6032): p. 960-3 [PMID:21551031] Miyashima S, et al. Mobile PEAR transcription factors integrate positional cues to prime cambial growth. Nature, 2019. 565(7740): p. 490-494 [PMID:30626969]