PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 125080 | ||||||||
Common Name | SELMODRAFT_125080 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 201aa MW: 21940.5 Da PI: 9.9671 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 91.5 | 6.5e-29 | 1 | 57 | 3 | 60 |
-SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS WRKY 3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 DgynWrKYGqK+vkg ++prsYYrCt+++C++kk vers +++++i+Y+g+H h+k 125080 1 DGYNWRKYGQKQVKGCDNPRSYYRCTHPDCSAKKLVERSV-SGETTQIVYKGDHSHSK 57 9***************************************.9**************85 PP | |||||||
2 | WRKY | 107.8 | 5.3e-34 | 116 | 174 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK+vkg+++prsYYrCt +gCpv+k+ver+a+dpk+v++ Yeg+H+h+ 125080 116 LDDGYRWRKYGQKVVKGNPNPRSYYRCTNPGCPVRKHVERAADDPKAVITSYEGKHDHD 174 59********************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50811 | 22.469 | 1 | 58 | IPR003657 | WRKY domain |
Gene3D | G3DSA:2.20.25.80 | 4.5E-24 | 1 | 58 | IPR003657 | WRKY domain |
Pfam | PF03106 | 4.4E-23 | 1 | 55 | IPR003657 | WRKY domain |
SMART | SM00774 | 1.3E-27 | 1 | 57 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 2.48E-22 | 1 | 58 | IPR003657 | WRKY domain |
Gene3D | G3DSA:2.20.25.80 | 3.7E-36 | 104 | 176 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 9.55E-30 | 108 | 176 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 37.08 | 111 | 176 | IPR003657 | WRKY domain |
SMART | SM00774 | 1.4E-39 | 116 | 175 | IPR003657 | WRKY domain |
Pfam | PF03106 | 9.9E-27 | 117 | 173 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 201 aa Download sequence Send to blast |
DGYNWRKYGQ KQVKGCDNPR SYYRCTHPDC SAKKLVERSV SGETTQIVYK GDHSHSKPQM 60 IRRLAVTRVQ PDDGSKRTLV LVPGGATPTP AQRHASNSNS SDAPVVVHTN SEVDVLDDGY 120 RWRKYGQKVV KGNPNPRSYY RCTNPGCPVR KHVERAADDP KAVITSYEGK HDHDTPAARG 180 GAASTSTTST KLLPAPPLSA * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 1e-38 | 1 | 177 | 8 | 78 | Probable WRKY transcription factor 4 |
2lex_A | 1e-38 | 1 | 177 | 8 | 78 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in starch synthesis (PubMed:12953112). Acts as a transcriptional activator in sugar signaling (PubMed:16167901). Interacts specifically with the SURE and W-box elements, but not with the SP8a element (PubMed:12953112). {ECO:0000269|PubMed:12953112, ECO:0000269|PubMed:16167901}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Up-regulated by sugar. {ECO:0000269|PubMed:12953112}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024516484.1 | 1e-138 | WRKY transcription factor WRKY24 | ||||
Swissprot | Q6VWJ6 | 3e-70 | WRK46_HORVU; WRKY transcription factor SUSIBA2 | ||||
TrEMBL | D8SU56 | 1e-145 | D8SU56_SELML; Uncharacterized protein (Fragment) | ||||
STRING | EFJ11950 | 1e-146 | (Selaginella moellendorffii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP14 | 17 | 875 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G07100.2 | 7e-72 | WRKY DNA-binding protein 26 |
Link Out ? help Back to Top | |
---|---|
Phytozome | 125080 |
Entrez Gene | 9642496 |
Publications ? help Back to Top | |||
---|---|---|---|
|