PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 118783 | ||||||||
Common Name | SELMODRAFT_118783, SELMODRAFT_129268 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
|
||||||||
Family | Nin-like | ||||||||
Protein Properties | Length: 66aa MW: 7722.07 Da PI: 11.8576 | ||||||||
Description | Nin-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | RWP-RK | 86.9 | 1.8e-27 | 5 | 54 | 2 | 51 |
RWP-RK 2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiks 51 + +++++dl+++F+lpi++AAkeLg+c+TvLK+iCR++G++RWPhRk++ 118783 5 TGKLKMSDLAQHFHLPINAAAKELGICPTVLKKICRRNGMRRWPHRKVSD 54 5689*******************************************976 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51519 | 16.142 | 1 | 65 | IPR003035 | RWP-RK domain |
Pfam | PF02042 | 9.9E-26 | 8 | 54 | IPR003035 | RWP-RK domain |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 66 aa Download sequence Send to blast |
QRERTGKLKM SDLAQHFHLP INAAAKELGI CPTVLKKICR RNGMRRWPHR KVSDVITSSR 60 WQHWF* |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002983687.2 | 5e-33 | protein NLP1 | ||||
TrEMBL | D8SK84 | 2e-41 | D8SK84_SELML; Uncharacterized protein (Fragment) | ||||
STRING | EFJ09812 | 3e-42 | (Selaginella moellendorffii) | ||||
STRING | EFJ15183 | 3e-42 | (Selaginella moellendorffii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP567 | 17 | 77 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G59580.2 | 1e-13 | Nin-like family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | 118783 |
Entrez Gene | 9628906 | 9643852 |
Publications ? help Back to Top | |||
---|---|---|---|
|