PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 115439
Common NameWOXII
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family WOX
Protein Properties Length: 87aa    MW: 10221.7 Da    PI: 9.6025
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
115439genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox49.95.5e-16161257
              T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
  Homeobox  2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
              r+R+++t+ q+ +Le  Fe+ +  p  ++++ +++ l     ++e +V++WFqNrRa+ k+
    115439  1 RPRWKPTPVQISILEYIFENsDLLPGDKDITIITDGLrlygPVEEVNVFYWFQNRRARAKR 61
              79*****************98999*************888889****************97 PP

2Wus_type_Homeobox79.35.3e-26261463
  Wus_type_Homeobox  4 tRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerq 63
                       +RW Ptp Qi iLe ++++    P  + i+ it  L+ yG +e+ NVfyWFQNr+aR ++
             115439  2 PRWKPTPVQISILEYIFENSDLLPGDKDITIITDGLRLYGPVEEVNVFYWFQNRRARAKR 61
                       7********************************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003897.8E-4166IPR001356Homeobox domain
PfamPF000461.4E-13161IPR001356Homeobox domain
CDDcd000862.82E-6162No hitNo description
Gene3DG3DSA:1.10.10.606.6E-9167IPR009057Homeodomain-like
PROSITE profilePS5007111.807162IPR001356Homeobox domain
SuperFamilySSF466892.99E-12168IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 87 aa     Download sequence    Send to blast
RPRWKPTPVQ ISILEYIFEN SDLLPGDKDI TIITDGLRLY GPVEEVNVFY WFQNRRARAK  60
RTANQEHHPK VRNFDPAKTL EPFEKL*
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFR8389501e-146Selaginella moellendorffii WOXII gene for putative transcription factor
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002981885.23e-59putative WUSCHEL-related homeobox 10
SwissprotO817882e-14WOX13_ARATH; WUSCHEL-related homeobox 13
TrEMBLH8WFF38e-58H8WFF3_SELML; Putative transcription factor
STRINGEFJ169787e-58(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP18731639
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35550.16e-17WUSCHEL related homeobox 13
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Dolzblasz A, et al.
    Stem Cell Regulation by Arabidopsis WOX Genes.
    Mol Plant, 2016. 9(7): p. 1028-39
    [PMID:27109605]