PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 111494 | ||||||||
Common Name | SELMODRAFT_111494 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 116aa MW: 13036 Da PI: 7.2698 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 98.9 | 4.9e-31 | 4 | 96 | 1 | 93 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkae 93 aC aC+ l+ +C+++C +apyf +qp++fanvh +FG+snv k+l++l +ed +++l+ye ++r++dP+yG+v+vi+ lq++ ++++++ 111494 4 ACTACRNLQWRCTPECLFAPYFLPDQPERFANVHNVFGVSNVRKMLNELLVYFHEDCIDTLAYEVDMRVEDPIYGCVSVISVLQKRAARTQNH 96 7************************************************************************************99998864 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 18.088 | 3 | 104 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 7.7E-33 | 4 | 96 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 116 aa Download sequence Send to blast |
TTSACTACRN LQWRCTPECL FAPYFLPDQP ERFANVHNVF GVSNVRKMLN ELLVYFHEDC 60 IDTLAYEVDM RVEDPIYGCV SVISVLQKRA ARTQNHKYLA LATPCSSSML SPGTR* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 2e-35 | 3 | 95 | 10 | 102 | LOB family transfactor Ramosa2.1 |
5ly0_B | 2e-35 | 3 | 95 | 10 | 102 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Negative regulator of cell proliferation in the adaxial side of leaves. Regulates the formation of a symmetric lamina and the establishment of venation (By similarity). {ECO:0000250}. | |||||
UniProt | Negative regulator of cell proliferation in the adaxial side of leaves. Regulates the formation of a symmetric lamina and the establishment of venation (By similarity). {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024356367.1 | 8e-38 | protein LATERAL ORGAN BOUNDARIES-like isoform X1 | ||||
Refseq | XP_024356368.1 | 6e-38 | protein LATERAL ORGAN BOUNDARIES-like isoform X2 | ||||
Refseq | XP_024356369.1 | 6e-38 | protein LATERAL ORGAN BOUNDARIES-like isoform X2 | ||||
Refseq | XP_024356370.1 | 6e-38 | protein LATERAL ORGAN BOUNDARIES-like isoform X2 | ||||
Refseq | XP_024356371.1 | 6e-38 | protein LATERAL ORGAN BOUNDARIES-like isoform X2 | ||||
Swissprot | A2WXT0 | 2e-35 | LBD6_ORYSI; LOB domain-containing protein 6 | ||||
Swissprot | Q8LQH4 | 2e-35 | LBD6_ORYSJ; LOB domain-containing protein 6 | ||||
TrEMBL | D8S900 | 1e-81 | D8S900_SELML; Uncharacterized protein (Fragment) | ||||
STRING | EFJ19118 | 2e-82 | (Selaginella moellendorffii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP60 | 16 | 318 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G65620.4 | 2e-37 | LBD family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | 111494 |
Entrez Gene | 9635545 |
Publications ? help Back to Top | |||
---|---|---|---|
|