PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 101484 | ||||||||
Common Name | SELMODRAFT_101484, SELMODRAFT_132315 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 89aa MW: 9967.53 Da PI: 10.1779 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 62.3 | 9.7e-20 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT+eEd +l+ +++q+G+g+W+t +++ g+ R++k+c++rw +yl 101484 14 RGPWTPEEDAKLLACIAQHGTGSWRTLPKKAGLQRCGKSCRLRWTNYL 61 89********************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 1.8E-26 | 5 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 25.716 | 9 | 65 | IPR017930 | Myb domain |
SMART | SM00717 | 5.3E-14 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.5E-17 | 14 | 61 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 2.49E-23 | 15 | 87 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.19E-11 | 16 | 61 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.0E-7 | 65 | 87 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 89 aa Download sequence Send to blast |
MGRAPCCEKD SVKRGPWTPE EDAKLLACIA QHGTGSWRTL PKKAGLQRCG KSCRLRWTNY 60 LRPDLKHGRF TDHEEQLIVK LHAALGSR* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 8e-16 | 14 | 88 | 7 | 80 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Essential for tapetum development in anthers and microsporogenesis. May regulate the timing of tapetal programmed cell death (PCD) which is critical for pollen development. {ECO:0000269|PubMed:22086333}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002974331.2 | 2e-58 | transcription factor MYB80 | ||||
Refseq | XP_002990860.2 | 2e-58 | transcription factor MYB80 | ||||
Swissprot | Q7XQN1 | 5e-45 | MYB80_ORYSJ; Transcription factor MYB80 | ||||
TrEMBL | A0A2K1J4Q5 | 2e-56 | A0A2K1J4Q5_PHYPA; Uncharacterized protein | ||||
TrEMBL | A0A2K1JHJ1 | 1e-56 | A0A2K1JHJ1_PHYPA; Uncharacterized protein | ||||
TrEMBL | A9RYY7 | 8e-58 | A9RYY7_PHYPA; Predicted protein (Fragment) | ||||
TrEMBL | D8RTQ7 | 1e-58 | D8RTQ7_SELML; Uncharacterized protein | ||||
STRING | PP1S36_198V6.1 | 5e-57 | (Physcomitrella patens) | ||||
STRING | PP1S65_211V6.1 | 1e-58 | (Physcomitrella patens) | ||||
STRING | EFJ08133 | 2e-59 | (Selaginella moellendorffii) | ||||
STRING | EFJ24553 | 2e-59 | (Selaginella moellendorffii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP5 | 17 | 1784 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G56110.1 | 1e-46 | myb domain protein 103 |
Link Out ? help Back to Top | |
---|---|
Phytozome | 101484 |
Entrez Gene | 9636425 | 9659436 |
Publications ? help Back to Top | |||
---|---|---|---|
|